RegulonDB RegulonDB 10.9: Gene Form
   

gmk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ligB gmk rpoZ yicG DksA-ppGpp DksA-ppGpp terminator terminator TSS_4236 (cluster) TSS_4236 (cluster) TSS_4235 TSS_4235 rpoZp rpoZp TSS_4233 TSS_4233 TSS_4232 (cluster) TSS_4232 (cluster) TSS_4231 TSS_4231 TSS_4230 (cluster) TSS_4230 (cluster) TSS_4229 (cluster) TSS_4229 (cluster) TSS_4228 TSS_4228 TSS_4227 TSS_4227 TSS_4226 TSS_4226 TSS_4225 TSS_4225 TSS_4224 (cluster) TSS_4224 (cluster) gmkp gmkp TSS_4222 TSS_4222 TSS_4221 TSS_4221 ligBp4 ligBp4 ligBp1 ligBp1

Gene      
Name: gmk    Texpresso search in the literature
Synonym(s): ECK3638, EG10965, b3648, spoR
Genome position(nucleotides): 3821428 --> 3822051 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.04
External database links:  
ASAP:
ABE-0011930
CGSC:
33871
ECHOBASE:
EB0958
ECOLIHUB:
gmk
OU-MICROARRAY:
b3648
STRING:
511145.b3648
COLOMBOS: gmk


Product      
Name: guanylate kinase
Synonym(s): Gmk, SpoR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.593
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
11 -> 18 APSGAGKS
5 -> 186 TLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAE
4 -> 184 GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.3 - purine ribonucleotide biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004385 - guanylate kinase activity
GO:0042802 - identical protein binding
biological_process GO:0006163 - purine nucleotide metabolic process
GO:0016310 - phosphorylation
GO:0046037 - GMP metabolic process
GO:0046710 - GDP metabolic process
External database links:  
ECOCYC:
GUANYL-KIN-MONOMER
ECOLIWIKI:
b3648
INTERPRO:
IPR027417
INTERPRO:
IPR020590
INTERPRO:
IPR017665
INTERPRO:
IPR008145
INTERPRO:
IPR008144
MODBASE:
P60546
PDB:
2F3T
PDB:
2F3R
PDB:
2ANC
PDB:
2ANB
PDB:
2AN9
PDB:
1S96
PFAM:
PF00625
PRIDE:
P60546
PROSITE:
PS00856
PROSITE:
PS50052
REFSEQ:
NP_418105
SMART:
SM00072
SMR:
P60546
UNIPROT:
P60546


Operon      
Name: gmk         
Operon arrangement:
Transcription unit        Promoter
gmk


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ligBp1 3821256 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ligBp4 3821288 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4221 3821384 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4222 3821386 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4224 (cluster) 3821395 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4225 3821401 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4226 3821411 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4227 3821413 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4228 3821861 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4229 (cluster) 3821923 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4230 (cluster) 3821985 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4231 3822034 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4232 (cluster) 3822036 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4233 3822040 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4235 3822245 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4236 (cluster) 3822249 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB