RegulonDB RegulonDB 10.9: Gene Form
   

trmH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

spoT recG trmH TSS_4243 TSS_4243 TSS_4242 TSS_4242 TSS_4241 TSS_4241 TSS_4240 TSS_4240 TSS_4239 TSS_4239 TSS_4238 (cluster) TSS_4238 (cluster) TSS_4237 TSS_4237

Gene      
Name: trmH    Texpresso search in the literature
Synonym(s): ECK3641, EG10967, b3651, spoU
Genome position(nucleotides): 3824515 --> 3825204 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.36
External database links:  
ASAP:
ABE-0011937
CGSC:
33877
ECHOBASE:
EB0960
ECOLIHUB:
trmH
OU-MICROARRAY:
b3651
STRING:
511145.b3651
COLOMBOS: trmH


Product      
Name: tRNA (Gm18) 2'-O-methyltransferase
Synonym(s): SpoU, TrmH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.343
Isoelectric point: 7.249
Motif(s):
 
Type Positions Sequence
20 -> 159 LTVCMEQVHKPHNVSAIIRTADAVGVHEVHAVWPGSRMRTMASAAAGSNSWVQVKTHRTIGDAVAHLKGQGMQILATHLSDNAVDFREIDYTRPTCILMGQEKTGITQEALALADQDIIIPMIGMVQSLNVSVASALILY
163 -> 218 RQRQNAGMYLRENSMLPEAEQQRLLFEGGYPVLAKVAKRKGLPYPHVNQQGEIEAD

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0008173 - RNA methyltransferase activity
GO:0003723 - RNA binding
GO:0000049 - tRNA binding
GO:0009020 - tRNA (guanosine-2'-O-)-methyltransferase activity
biological_process GO:0030488 - tRNA methylation
GO:0006396 - RNA processing
GO:0008033 - tRNA processing
GO:0032259 - methylation
GO:0002938 - tRNA guanine ribose methylation
Note(s): Note(s): ...[more].
Reference(s): [1] Gustafsson C., et al., 1996
[2] Kinghorn SM., et al., 2002
External database links:  
DIP:
DIP-35977N
ECOCYC:
EG10967-MONOMER
ECOLIWIKI:
b3651
INTERPRO:
IPR033671
INTERPRO:
IPR001537
INTERPRO:
IPR022724
INTERPRO:
IPR029026
INTERPRO:
IPR029028
MODBASE:
P0AGJ2
PFAM:
PF00588
PFAM:
PF12105
PRIDE:
P0AGJ2
PRODB:
PRO_000024115
REFSEQ:
NP_418108
SMR:
P0AGJ2
SWISSMODEL:
P0AGJ2
UNIPROT:
P0AGJ2


Operon      
Name: rpoZ-spoT-trmH-recG         
Operon arrangement:
Transcription unit        Promoter
rpoZ-spoT-trmH-recG
recG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4237 3823562 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4238 (cluster) 3823568 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4239 3823619 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4240 3824410 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4241 3824657 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4242 3826330 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4243 3826678 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gustafsson C., Reid R., Greene PJ., Santi DV., 1996, Identification of new RNA modifying enzymes by iterative genome search using known modifying enzymes as probes., Nucleic Acids Res 24(19):3756-62

 [2] Kinghorn SM., O'Byrne CP., Booth IR., Stansfield I., 2002, Physiological analysis of the role of truB in Escherichia coli: a role for tRNA modification in extreme temperature resistance., Microbiology 148(Pt 11):3511-20

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB