RegulonDB RegulonDB 10.8: Gene Form
   

srlE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mltB srlE srlA srlB CRP CRP srlAp srlAp TSS_3016 TSS_3016

Gene      
Name: srlE    Texpresso search in the literature
Synonym(s): ECK2698, EG10969, b2703, gutA, gutE, sbl, srlA, srlA-2
Genome position(nucleotides): 2826392 --> 2827351 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.69
External database links:  
ASAP:
ABE-0008892
CGSC:
155
ECHOBASE:
EB4116
ECOO157CYC:
SRLE_2
OU-MICROARRAY:
b2703
PortEco:
srlE
STRING:
511145.b2703
COLOMBOS: srlE


Product      
Name: sorbitol-specific PTS enzyme IIBC1 component
Synonym(s): Enzyme IIB sorbitol, GutA, GutE, Sbl, SrlA, SrlE, enzyme IIB component of sorbitol PTS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.332
Isoelectric point: 7.029
Motif(s):
 
Type Positions Sequence
177 -> 197 ILPFMAFVSALIGIIMASGLG
257 -> 277 LALPALFAINAQAACDFIPVG
297 -> 317 VSRFLTGAPTVLIAWFVSGFI
226 -> 318 LSPFLGPGAVIAQVIGVLIGVQIGLGNIPPHLALPALFAINAQAACDFIPVGLSLAEARQDTVRVGVPSVLVSRFLTGAPTVLIAWFVSGFIY
4 -> 171 IRIEKGTGGWGGPLELKATPGKKIVYITAGTRPAIVDKLAQLTGWQAIDGFKEGEPAEAEIGVAVIDCGGTLRCGIYPKRRIPTINIHSTGKSGPLAQYIVEDIYVSGVKEENITVVGDATPQPSSVGRDYDTSKKITEQSDGLLAKVGMGMGSTVAVLFQSGRDTID

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
GUTA-MONOMER
ECOLIWIKI:
b2703
INTERPRO:
IPR011638
INTERPRO:
IPR011618
INTERPRO:
IPR004702
PANTHER:
PTHR39427
PFAM:
PF07663
PFAM:
PF03612
PRIDE:
P56580
PRODB:
PRO_000023986
PROSITE:
PS51102
REFSEQ:
YP_026181
SMR:
P56580
UNIPROT:
P56580


Operon      
Name: srlAEBD-gutM-srlR-gutQ         
Operon arrangement:
Transcription unit        Promoter
srlAEBD-gutM-srlR-gutQ
srlR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, GutM
Repressed by: SrlR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3016 2825541 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB