RegulonDB RegulonDB 10.8: Gene Form
   

srlB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

srlE srlD srlB srlA

Gene      
Name: srlB    Texpresso search in the literature
Synonym(s): ECK2699, EG10970, b2704, gutB
Genome position(nucleotides): 2827362 --> 2827733 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.11
External database links:  
ASAP:
ABE-0008894
CGSC:
11886
ECHOBASE:
EB0963
OU-MICROARRAY:
b2704
PortEco:
srlB
STRING:
511145.b2704
COLOMBOS: srlB


Product      
Name: sorbitol-specific PTS enzyme IIA component
Synonym(s): Enzyme IIIsorbitol, GutB, SrlB, enzyme IIA component of sorbitol PTS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.304
Isoelectric point: 4.685
Motif(s):
 
Type Positions Sequence
4 -> 115 IYQTTITRIGASAIDALSDQMLITFREGAPADLEEYCFIHCHGELKGALHPGLQFSLGQHRYPVTAVGSVAEDNLRELGHVTLRFDGLNEAEFPGTVHVAGPVPDDIAPGSV
51 -> 51 A
62 -> 62 Q
122 -> 122 K
59 -> 59 S

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
GUTB-MONOMER
ECOLIWIKI:
b2704
INTERPRO:
IPR018454
INTERPRO:
IPR036665
INTERPRO:
IPR004716
PANTHER:
PTHR40398
PFAM:
PF03829
PRIDE:
P05706
PRODB:
PRO_000023984
PRODOM:
PD015842
PROSITE:
PS51097
REFSEQ:
NP_417184
SMR:
P05706
SWISSMODEL:
P05706
UNIPROT:
P05706


Operon      
Name: srlAEBD-gutM-srlR-gutQ         
Operon arrangement:
Transcription unit        Promoter
srlAEBD-gutM-srlR-gutQ
srlR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, GutM
Repressed by: SrlR


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB