RegulonDB RegulonDB 10.8: Gene Form
   

srlD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

srlD srlB gutM TSS_3017 (cluster) TSS_3017 (cluster) srlRp srlRp

Gene      
Name: srlD    Texpresso search in the literature
Synonym(s): ECK2700, EG10971, b2705, gutD
Genome position(nucleotides): 2827737 --> 2828516 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.33
Reference(s): [1] Yamada M., et al., 1987
External database links:  
ASAP:
ABE-0008896
CGSC:
153
ECHOBASE:
EB0964
OU-MICROARRAY:
b2705
PortEco:
srlD
STRING:
511145.b2705
COLOMBOS: srlD


Product      
Name: sorbitol-6-phosphate 2-dehydrogenase
Synonym(s): GutD, SrlD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.858
Isoelectric point: 6.262
Motif(s):
 
Type Positions Sequence
4 -> 33 VAVVIGGGQTLGAFLCHGLAAEGYRVAVVD
3 -> 197 QVAVVIGGGQTLGAFLCHGLAAEGYRVAVVDIQSDKAANVAQEINAEYGESMAYGFGADATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCAREFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSLMLGNLLKSPMFQSLL
68 -> 68 V

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0009010 - sorbitol-6-phosphate 2-dehydrogenase activity
GO:0042802 - identical protein binding
biological_process GO:0055114 - oxidation-reduction process
GO:0051289 - protein homotetramerization
GO:0006062 - sorbitol catabolic process
External database links:  
DIP:
DIP-10917N
ECOCYC:
SORB6PDEHYDROG-MONOMER
ECOLIWIKI:
b2705
INTERPRO:
IPR002347
INTERPRO:
IPR020904
INTERPRO:
IPR036291
MODBASE:
P05707
PANTHER:
PTHR24322
PFAM:
PF00106
PRIDE:
P05707
PRINTS:
PR00081
PRINTS:
PR00080
PRODB:
PRO_000023985
PROSITE:
PS00061
REFSEQ:
NP_417185
SMR:
P05707
UNIPROT:
P05707


Operon      
Name: srlAEBD-gutM-srlR-gutQ         
Operon arrangement:
Transcription unit        Promoter
srlAEBD-gutM-srlR-gutQ
srlR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, GutM
Repressed by: SrlR


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3017 (cluster) 2828961 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Yamada M., Saier MH., 1987, Physical and genetic characterization of the glucitol operon in Escherichia coli., J Bacteriol 169(7):2990-4

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB