RegulonDB RegulonDB 10.8: Gene Form
   

gutQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

norR norV gutQ srlR gutM norW IHF IHF NarP NarL NarP NarL NorR NorR NorR FNR NsrR terminator norVp norVp norRp norRp TSS_3019 TSS_3019 TSS_3018 (cluster) TSS_3018 (cluster) TSS_3017 (cluster) TSS_3017 (cluster) srlRp srlRp

Gene      
Name: gutQ    Texpresso search in the literature
Synonym(s): ECK2703, EG10973, b2708, srlQ
Genome position(nucleotides): 2829813 --> 2830778 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.35
External database links:  
ASAP:
ABE-0008902
CGSC:
33206
ECHOBASE:
EB0966
OU-MICROARRAY:
b2708
PortEco:
gutQ
STRING:
511145.b2708
COLOMBOS: gutQ


Product      
Name: D-arabinose 5-phosphate isomerase GutQ
Synonym(s): GutQ, SrlQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.031
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
269 -> 321 MTVGGTTLQSQSRAIDAKEILMKRKITAAPVVDENGKLTGAINLQDFYQAGII
141 -> 143 SVE
34 -> 177 AANIILHCEGKVVVSGIGKSGHIGKKIAATLASTGTPAFFVHPAEALHGDLGMIESRDVMLFISYSGGAKELDLIIPRLEDKSIALLAMTGKPTSPLGLAAKAVLDISVEREACPMHLAPTSSTVNTLMMGDALAMAVMQARGF
49 -> 54 GIGKSG
203 -> 261 MRRDDAIPQVALTASVMDAMLELSRTGLGLVAVCDAQQQVQGVFTDGDLRRWLVGGGAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0019146 - arabinose-5-phosphate isomerase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
GO:0097367 - carbohydrate derivative binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0019294 - keto-3-deoxy-D-manno-octulosonic acid biosynthetic process
GO:0044010 - single-species biofilm formation
GO:0051289 - protein homotetramerization
GO:1901135 - carbohydrate derivative metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10973-MONOMER
ECOLIWIKI:
b2708
INTERPRO:
IPR004800
INTERPRO:
IPR035474
INTERPRO:
IPR000644
INTERPRO:
IPR001347
MODBASE:
P17115
PFAM:
PF00571
PFAM:
PF01380
PRIDE:
P17115
PROSITE:
PS51464
PROSITE:
PS51371
REFSEQ:
NP_417188
SMART:
SM00116
SMR:
P17115
UNIPROT:
P17115


Operon      
Name: srlAEBD-gutM-srlR-gutQ         
Operon arrangement:
Transcription unit        Promoter
srlAEBD-gutM-srlR-gutQ
srlR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, GutM
Repressed by: SrlR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3017 (cluster) 2828961 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3018 (cluster) 2829709 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3019 2829746 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB