RegulonDB RegulonDB 10.8: Gene Form
   

ssb gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uvrA ssb yjcB ArcA ArcA ArcA LexA ArcA ssbp1 ssbp1 ssbp2 ssbp2 ssbp3 ssbp3 uvrAp uvrAp TSS_4897 (cluster) TSS_4897 (cluster) TSS_4896 TSS_4896

Gene      
Name: ssb    Texpresso search in the literature
Synonym(s): ECK4051, EG10976, b4059, exrB, lexC
Genome position(nucleotides): 4274125 --> 4274661 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.1
External database links:  
ASAP:
ABE-0013298
CGSC:
150
ECHOBASE:
EB0969
OU-MICROARRAY:
b4059
PortEco:
ssb
STRING:
511145.b4059
COLOMBOS: ssb


Product      
Name: ssDNA-binding protein
Synonym(s): ExrB, LexC, Ssb
Sequence: Get amino acid sequence Fasta Format
Cellular location: bacterial nucleoid,cytosol
Molecular weight: 18.975
Isoelectric point: 5.232
Motif(s):
 
Type Positions Sequence
5 -> 5 G
134 -> 134 G
170 -> 178 MDFDDDIPF
1 -> 112 MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQM
11 -> 11 L

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009295 - nucleoid
molecular_function GO:0003677 - DNA binding
GO:0003697 - single-stranded DNA binding
GO:0005515 - protein binding
GO:0008047 - enzyme activator activity
GO:0042802 - identical protein binding
biological_process GO:0051096 - positive regulation of helicase activity
GO:0006260 - DNA replication
GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0006298 - mismatch repair
GO:0043085 - positive regulation of catalytic activity
GO:0000725 - recombinational repair
External database links:  
DIP:
DIP-35980N
DISPROT:
DP02137
ECOCYC:
EG10976-MONOMER
ECOLIWIKI:
b4059
INTERPRO:
IPR000424
INTERPRO:
IPR011344
INTERPRO:
IPR012340
MINT:
P0AGE0
PANTHER:
PTHR10302
PDB:
4Z0U
PDB:
4MZ9
PDB:
3SXU
PDB:
3C94
PDB:
1SRU
PDB:
1QVC
PDB:
1KAW
PDB:
1EYG
PDB:
1EQQ
PDB:
3UF7
PFAM:
PF00436
PRIDE:
P0AGE0
PRODB:
PRO_000023989
PROSITE:
PS50935
REFSEQ:
NP_418483
SMR:
P0AGE0
SWISSMODEL:
P0AGE0
UNIPROT:
P0AGE0


Operon      
Name: ssb         
Operon arrangement:
Transcription unit        Promoter
ssb
ssb
ssb


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4896 4273337 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4897 (cluster) 4273934 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB