RegulonDB RegulonDB 10.9: Gene Form
   

sucB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: sucB    Texpresso search in the literature
Synonym(s): ECK0715, EG10980, b0727
Genome position(nucleotides): 761522 --> 762739 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.91
External database links:  
ASAP:
ABE-0002480
CGSC:
145
ECHOBASE:
EB0973
ECOLIHUB:
sucB
OU-MICROARRAY:
b0727
STRING:
511145.b0727
COLOMBOS: sucB


Product      
Name: dihydrolipoyltranssuccinylase
Synonym(s): E2(o) subunit, SucB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.011
Isoelectric point: 5.55
Motif(s):
 
Type Positions Sequence
113 -> 150 ALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHL
175 -> 403 SEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL
5 -> 76 DILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAVLEDEGTTVTSRQILGR
114 -> 147 LSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVE
2 -> 405 SSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAVLEDEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAAAPAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0045252 - oxoglutarate dehydrogenase complex
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0004149 - dihydrolipoyllysine-residue succinyltransferase activity
GO:0031405 - lipoic acid binding
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0033512 - L-lysine catabolic process to acetyl-CoA via saccharopine
Reference(s): [1] Spencer ME., et al., 1984
External database links:  
DIP:
DIP-35787N
ECOCYC:
E2O-MONOMER
ECOLIWIKI:
b0727
INTERPRO:
IPR003016
INTERPRO:
IPR006255
INTERPRO:
IPR000089
INTERPRO:
IPR001078
INTERPRO:
IPR023213
INTERPRO:
IPR036625
INTERPRO:
IPR004167
INTERPRO:
IPR011053
PDB:
2WXC
PDB:
6PBR
PDB:
2BTH
PDB:
2BTG
PDB:
1W4H
PDB:
1SCZ
PDB:
1BAL
PDB:
1BBL
PDB:
1C4T
PDB:
1E2O
PDB:
1PMR
PFAM:
PF00364
PFAM:
PF00198
PFAM:
PF02817
PRIDE:
P0AFG6
PRODB:
PRO_000024003
PROSITE:
PS51826
PROSITE:
PS00189
PROSITE:
PS50968
REFSEQ:
NP_415255
SMR:
P0AFG6
SWISSMODEL:
P0AFG6
UNIPROT:
P0AFG6


Operon      
Name: sdhCDAB-sucABCD-sdhX         
Operon arrangement:
Transcription unit        Promoter
sdhCDAB-sucABCD-sdhX
sdhDAB
sucAB
sucABCD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fur, ArcA
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_847 761388 forward nd [RS-EPT-CBR] [2]
  promoter TSS_848 (cluster) 761444 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_849 761455 forward nd [RS-EPT-CBR] [2]
  promoter TSS_850 761476 forward nd [RS-EPT-CBR] [2]
  promoter TSS_851 761724 forward nd [RS-EPT-CBR] [2]
  promoter TSS_852 761850 forward nd [RS-EPT-CBR] [2]
  promoter TSS_853 (cluster) 762415 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_854 (cluster) 762749 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_855 762984 forward nd [RS-EPT-CBR] [2]
  promoter TSS_856 762991 forward nd [RS-EPT-CBR] [2]
  promoter TSS_857 763299 forward nd [RS-EPT-CBR] [2]



RegulonDB