RegulonDB RegulonDB 10.8: Gene Form
   

sucB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sucA sucB sucC b0725 TSS_857 TSS_857 TSS_856 TSS_856 TSS_855 TSS_855 TSS_854 (cluster) TSS_854 (cluster) TSS_853 (cluster) TSS_853 (cluster) TSS_852 TSS_852 TSS_851 TSS_851 TSS_850 TSS_850 TSS_849 TSS_849 TSS_848 (cluster) TSS_848 (cluster) TSS_847 TSS_847

Gene      
Name: sucB    Texpresso search in the literature
Synonym(s): ECK0715, EG10980, b0727
Genome position(nucleotides): 761522 --> 762739 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.91
External database links:  
ASAP:
ABE-0002480
CGSC:
145
ECHOBASE:
EB0973
OU-MICROARRAY:
b0727
PortEco:
sucB
STRING:
511145.b0727
COLOMBOS: sucB


Product      
Name: dihydrolipoyltranssuccinylase
Synonym(s): E2(o) subunit, SucB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.011
Isoelectric point: 5.55
Motif(s):
 
Type Positions Sequence
113 -> 150 ALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHL
175 -> 403 SEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL
5 -> 76 DILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAVLEDEGTTVTSRQILGR
114 -> 147 LSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVE
2 -> 405 SSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAVLEDEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAAAPAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0045252 - oxoglutarate dehydrogenase complex
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0004149 - dihydrolipoyllysine-residue succinyltransferase activity
GO:0031405 - lipoic acid binding
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0033512 - L-lysine catabolic process to acetyl-CoA via saccharopine
Reference(s): [1] Spencer ME., et al., 1984
External database links:  
DIP:
DIP-35787N
ECOCYC:
E2O-MONOMER
ECOLIWIKI:
b0727
INTERPRO:
IPR000089
INTERPRO:
IPR006255
INTERPRO:
IPR011053
INTERPRO:
IPR036625
INTERPRO:
IPR001078
INTERPRO:
IPR003016
INTERPRO:
IPR004167
INTERPRO:
IPR023213
MINT:
MINT-1242608
PDB:
2WXC
PDB:
2BTH
PDB:
1W4H
PDB:
1SCZ
PDB:
1PMR
PDB:
1E2O
PDB:
1C4T
PDB:
1BBL
PDB:
1BAL
PDB:
2BTG
PFAM:
PF00198
PFAM:
PF00364
PFAM:
PF02817
PRIDE:
P0AFG6
PRODB:
PRO_000024003
PROSITE:
PS50968
PROSITE:
PS51826
PROSITE:
PS00189
REFSEQ:
NP_415255
SMR:
P0AFG6
SWISSMODEL:
P0AFG6
UNIPROT:
P0AFG6


Operon      
Name: sdhCDAB-sucABCD-sdhX         
Operon arrangement:
Transcription unit        Promoter
sdhCDAB-sucABCD-sdhX
sdhDAB
sucAB
sucABCD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fur, ArcA
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_847 761388 forward nd [RS-EPT-CBR] [2]
  promoter TSS_848 (cluster) 761444 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_849 761455 forward nd [RS-EPT-CBR] [2]
  promoter TSS_850 761476 forward nd [RS-EPT-CBR] [2]
  promoter TSS_851 761724 forward nd [RS-EPT-CBR] [2]
  promoter TSS_852 761850 forward nd [RS-EPT-CBR] [2]
  promoter TSS_853 (cluster) 762415 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_854 (cluster) 762749 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_855 762984 forward nd [RS-EPT-CBR] [2]
  promoter TSS_856 762991 forward nd [RS-EPT-CBR] [2]
  promoter TSS_857 763299 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Spencer ME., Darlison MG., Stephens PE., Duckenfield IK., Guest JR., 1984, Nucleotide sequence of the sucB gene encoding the dihydrolipoamide succinyltransferase of Escherichia coli K12 and homology with the corresponding acetyltransferase., Eur J Biochem 141(2):361-74

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB