RegulonDB RegulonDB 10.8: Gene Form
   

sucC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sucB sucC sucD sdhX TSS_860 TSS_860 TSS_859 TSS_859 TSS_858 TSS_858 TSS_857 TSS_857 TSS_856 TSS_856 TSS_855 TSS_855 TSS_854 (cluster) TSS_854 (cluster) TSS_853 (cluster) TSS_853 (cluster) TSS_852 TSS_852 TSS_851 TSS_851

Gene      
Name: sucC    Texpresso search in the literature
Synonym(s): ECK0716, EG10981, b0728
Genome position(nucleotides): 763014 --> 764180 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.33
External database links:  
ASAP:
ABE-0002483
CGSC:
17845
ECHOBASE:
EB0974
MIM:
612073
OU-MICROARRAY:
b0728
PortEco:
sucC
STRING:
511145.b0728
COLOMBOS: sucC


Product      
Name: succinyl-CoA synthetase subunit β
Synonym(s): beta; subunit, SucC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.393
Isoelectric point: 5.181
Motif(s):
 
Type Positions Sequence
262 -> 382 MVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTEAFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKKLADSGLNIIAAKGLTDAAQQVV
53 -> 55 GRG
197 -> 197 E
321 -> 323 GIV
9 -> 244 KQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDPREAQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009361 - succinate-CoA ligase complex (ADP-forming)
GO:0042709 - succinate-CoA ligase complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004775 - succinate-CoA ligase (ADP-forming) activity
GO:0000287 - magnesium ion binding
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0006104 - succinyl-CoA metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Nishimura JS., et al., 1993
External database links:  
DIP:
DIP-31852N
ECOCYC:
SUCCCOASYN-BETA
ECOLIWIKI:
b0728
INTERPRO:
IPR005809
INTERPRO:
IPR013815
INTERPRO:
IPR013650
INTERPRO:
IPR016102
INTERPRO:
IPR017866
INTERPRO:
IPR011761
INTERPRO:
IPR005811
MODBASE:
P0A836
PANTHER:
PTHR11815
PDB:
2NUA
PDB:
2NU9
PDB:
2NU8
PDB:
2NU7
PDB:
2NU6
PDB:
1SCU
PDB:
1JLL
PDB:
1JKJ
PDB:
1CQJ
PDB:
1CQI
PDB:
2SCU
PFAM:
PF08442
PFAM:
PF00549
PRIDE:
P0A836
PRODB:
PRO_000024004
PROSITE:
PS01217
PROSITE:
PS50975
REFSEQ:
NP_415256
SMR:
P0A836
UNIPROT:
P0A836


Operon      
Name: sdhCDAB-sucABCD-sdhX         
Operon arrangement:
Transcription unit        Promoter
sdhCDAB-sucABCD-sdhX
sdhDAB
sucAB
sucABCD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fur, ArcA
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_851 761724 forward nd [RS-EPT-CBR] [2]
  promoter TSS_852 761850 forward nd [RS-EPT-CBR] [2]
  promoter TSS_853 (cluster) 762415 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_854 (cluster) 762749 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_855 762984 forward nd [RS-EPT-CBR] [2]
  promoter TSS_856 762991 forward nd [RS-EPT-CBR] [2]
  promoter TSS_857 763299 forward nd [RS-EPT-CBR] [2]
  promoter TSS_858 764187 forward nd [RS-EPT-CBR] [2]
  promoter TSS_859 764211 forward nd [RS-EPT-CBR] [2]
  promoter TSS_860 764423 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nishimura JS., Ybarra J., Mann CJ., Mitchell T., 1993, Sensitivity of Escherichia coli succinyl-CoA mutants at Trp beta 76 to clostripain and to trypsin. ADP and ATP protect against cleavage by clostripain at Arg beta 80., J Biol Chem 268(18):13717-22

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB