RegulonDB RegulonDB 10.9: Gene Form
   

sucC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sucB sucC sucD sdhX TSS_860 TSS_860 TSS_859 TSS_859 TSS_858 TSS_858 TSS_857 TSS_857 TSS_856 TSS_856 TSS_855 TSS_855 TSS_854 (cluster) TSS_854 (cluster) TSS_853 (cluster) TSS_853 (cluster) TSS_852 TSS_852 TSS_851 TSS_851

Gene      
Name: sucC    Texpresso search in the literature
Synonym(s): ECK0716, EG10981, b0728
Genome position(nucleotides): 763014 --> 764180 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.33
External database links:  
ASAP:
ABE-0002483
CGSC:
17845
ECHOBASE:
EB0974
ECOLIHUB:
sucC
MIM:
612073
OU-MICROARRAY:
b0728
STRING:
511145.b0728
COLOMBOS: sucC


Product      
Name: succinyl-CoA synthetase subunit β
Synonym(s): beta; subunit, SucC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.393
Isoelectric point: 5.181
Motif(s):
 
Type Positions Sequence
262 -> 382 MVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTEAFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKKLADSGLNIIAAKGLTDAAQQVV
53 -> 55 GRG
197 -> 197 E
321 -> 323 GIV
9 -> 244 KQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDPREAQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009361 - succinate-CoA ligase complex (ADP-forming)
GO:0042709 - succinate-CoA ligase complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004775 - succinate-CoA ligase (ADP-forming) activity
GO:0000287 - magnesium ion binding
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0006104 - succinyl-CoA metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Nishimura JS., et al., 1993
External database links:  
DIP:
DIP-31852N
ECOCYC:
SUCCCOASYN-BETA
ECOLIWIKI:
b0728
INTERPRO:
IPR017866
INTERPRO:
IPR016102
INTERPRO:
IPR013815
INTERPRO:
IPR013650
INTERPRO:
IPR011761
INTERPRO:
IPR005811
INTERPRO:
IPR005809
MODBASE:
P0A836
PANTHER:
PTHR11815
PDB:
2SCU
PDB:
2NUA
PDB:
2NU8
PDB:
2NU9
PDB:
1SCU
PDB:
2NU6
PDB:
2NU7
PDB:
1CQI
PDB:
1CQJ
PDB:
1JKJ
PDB:
1JLL
PFAM:
PF00549
PFAM:
PF08442
PRIDE:
P0A836
PRODB:
PRO_000024004
PROSITE:
PS01217
PROSITE:
PS50975
REFSEQ:
NP_415256
SMR:
P0A836
UNIPROT:
P0A836


Operon      
Name: sdhCDAB-sucABCD-sdhX         
Operon arrangement:
Transcription unit        Promoter
sdhCDAB-sucABCD-sdhX
sdhDAB
sucAB
sucABCD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fur, ArcA
Repressed by: FNR, IHF, ArcA


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_851 761724 forward nd [RS-EPT-CBR] [2]
  promoter TSS_852 761850 forward nd [RS-EPT-CBR] [2]
  promoter TSS_853 (cluster) 762415 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_854 (cluster) 762749 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_855 762984 forward nd [RS-EPT-CBR] [2]
  promoter TSS_856 762991 forward nd [RS-EPT-CBR] [2]
  promoter TSS_857 763299 forward nd [RS-EPT-CBR] [2]
  promoter TSS_858 764187 forward nd [RS-EPT-CBR] [2]
  promoter TSS_859 764211 forward nd [RS-EPT-CBR] [2]
  promoter TSS_860 764423 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nishimura JS., Ybarra J., Mann CJ., Mitchell T., 1993, Sensitivity of Escherichia coli succinyl-CoA mutants at Trp beta 76 to clostripain and to trypsin. ADP and ATP protect against cleavage by clostripain at Arg beta 80., J Biol Chem 268(18):13717-22

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB