RegulonDB RegulonDB 10.8: Gene Form
   

suhB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfhR suhB trmJ terminator anti-terminator anti-anti-terminator yfhRp2 yfhRp2 yfhRp4 yfhRp4 TSS_2834 TSS_2834 TSS_2833 (cluster) TSS_2833 (cluster) TSS_2832 TSS_2832

Gene      
Name: suhB    Texpresso search in the literature
Synonym(s): ECK2530, EG10983, b2533, ssyA
Genome position(nucleotides): 2663442 --> 2664245 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.48
External database links:  
ASAP:
ABE-0008337
CGSC:
32968
ECHOBASE:
EB0976
OU-MICROARRAY:
b2533
PortEco:
suhB
STRING:
511145.b2533
COLOMBOS: suhB


Product      
Name: inositol-phosphate phosphatase
Synonym(s): SsyA, SuhB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.172
Isoelectric point: 6.971
Motif(s):
 
Type Positions Sequence
86 -> 89 LDGT
141 -> 141 R
2 -> 259 HPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYPQHTIITEESGELEGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYATTYINIVGKLFNECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNYMLTGNIVAGNPRVVKAMLANMRD

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008934 - inositol monophosphate 1-phosphatase activity
GO:0000287 - magnesium ion binding
GO:0043175 - RNA polymerase core enzyme binding
GO:0047954 - glycerol-2-phosphatase activity
GO:0031403 - lithium ion binding
GO:0052834 - inositol monophosphate phosphatase activity
GO:0052832 - inositol monophosphate 3-phosphatase activity
GO:0052833 - inositol monophosphate 4-phosphatase activity
biological_process GO:0007165 - signal transduction
GO:0006020 - inositol metabolic process
GO:0046855 - inositol phosphate dephosphorylation
GO:0046854 - phosphatidylinositol phosphorylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10983-MONOMER
ECOLIWIKI:
b2533
INTERPRO:
IPR000760
INTERPRO:
IPR020550
INTERPRO:
IPR020583
INTERPRO:
IPR033942
INTERPRO:
IPR022337
MODBASE:
P0ADG4
PANTHER:
PTHR20854
PDB:
6IB8
PDB:
2QFL
PDB:
6IB7
PFAM:
PF00459
PRIDE:
P0ADG4
PRINTS:
PR00377
PRINTS:
PR01959
PRODB:
PRO_000024012
PROSITE:
PS00629
PROSITE:
PS00630
REFSEQ:
NP_417028
SMR:
P0ADG4
UNIPROT:
P0ADG4


Operon      
Name: suhB         
Operon arrangement:
Transcription unit        Promoter
suhB


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2832 2663305 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2833 (cluster) 2663405 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2834 2663415 forward nd [RS-EPT-CBR] [1]
  promoter yfhRp4 2664204 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfhRp2 2664244 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB