RegulonDB RegulonDB 10.7: Gene Form
   

surA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lptD surA pdxA rsmA TSS_109 TSS_109 TSS_108 (cluster) TSS_108 (cluster) TSS_107 TSS_107 TSS_106 TSS_106 TSS_105 TSS_105 TSS_104 TSS_104 TSS_103 (cluster) TSS_103 (cluster) TSS_102 (cluster) TSS_102 (cluster) TSS_101 TSS_101 TSS_100 TSS_100 TSS_99 TSS_99 TSS_98 TSS_98 TSS_97 TSS_97 TSS_96 (cluster) TSS_96 (cluster) TSS_95 TSS_95 TSS_94 TSS_94 TSS_93 TSS_93 TSS_92 TSS_92 TSS_91 TSS_91 TSS_90 TSS_90 rsmAp rsmAp TSS_89 TSS_89 TSS_88 TSS_88 TSS_87 (cluster) TSS_87 (cluster) TSS_86 TSS_86 apaGp apaGp TSS_84 TSS_84

Gene      
Name: surA    Texpresso search in the literature
Synonym(s): ECK0054, EG10985, b0053
Genome position(nucleotides): 53416 <-- 54702 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.85
External database links:  
ASAP:
ABE-0000180
CGSC:
30326
ECHOBASE:
EB0978
OU-MICROARRAY:
b0053
PORTECO:
surA
REGULONDB:
b0053
STRING:
511145.b0053
M3D: surA
COLOMBOS: surA
PortEco: b0053


Product      
Name: peptidyl-prolyl cis-trans isomerase SurA
Synonym(s): PPIase, SurA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 47.284
Isoelectric point: 6.985
Motif(s):
 
Type Positions Sequence
21 -> 428 APQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQNDASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNISVTEVHARHILLKPSPIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNRKFSEEAASWMQEQRASAYVKILSN
116 -> 116 S
282 -> 382 VTEVHARHILLKPSPIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLD
25 -> 25 V
171 -> 272 STELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVND

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0051082 - unfolded protein binding
GO:0003755 - peptidyl-prolyl cis-trans isomerase activity
GO:0042277 - peptide binding
biological_process GO:0006457 - protein folding
GO:0042710 - biofilm formation
GO:0050821 - protein stabilization
GO:0043165 - Gram-negative-bacterium-type cell outer membrane assembly
GO:0060274 - maintenance of stationary phase
GO:0061077 - chaperone-mediated protein folding
GO:0000413 - protein peptidyl-prolyl isomerization
Note(s): Note(s): ...[more].
Reference(s): [1] Bothmann H., et al., 2000
[2] Cook GM., et al., 1997
[3] Costello SM., et al., 2016
[4] Dartigalongue C., et al., 2001
[5] Ma HW., et al., 2004
[6] Mogensen JE., et al., 2005
[7] O'Reilly EK., et al., 2004
[8] Pease AJ., et al., 2002
[9] Rouviere PE., et al., 1995
[10] Rudd KE., et al., 1995
[11] Vulic M., et al., 2002
[12] Werner J., et al., 2005
[13] Zhong M., et al., 2013
External database links:  
DIP:
DIP-35827N
ECOCYC:
EG10985-MONOMER
ECOLIWIKI:
b0053
INTERPRO:
IPR023034
INTERPRO:
IPR015391
INTERPRO:
IPR027304
INTERPRO:
IPR000297
INTERPRO:
IPR023058
MINT:
MINT-1242178
MODBASE:
P0ABZ6
PDB:
2PV3
PDB:
2PV2
PDB:
2PV1
PDB:
1M5Y
PFAM:
PF00639
PFAM:
PF09312
PRIDE:
P0ABZ6
PRODB:
PRO_000024015
PROSITE:
PS50198
PROSITE:
PS01096
PROTEINMODELPORTAL:
P0ABZ6
REFSEQ:
NP_414595
SMR:
P0ABZ6
UNIPROT:
P0ABZ6


Operon      
Name: lptD-surA-pdxA-rsmA-apaGH         
Operon arrangement:
Transcription unit        Promoter
apaGH
rsmA-apaGH
imp
imp
imp-surA-pdxA
pdxA-rsmA
pdxA-rsmA-apaGH
surA-pdxA-rsmA-apaGH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_84 51998 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_86 52194 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_87 (cluster) 52478 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [14]
  promoter TSS_88 52548 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_89 52587 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_90 53904 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_91 54275 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_92 54363 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_93 54605 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_94 54746 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_95 54754 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_96 (cluster) 54762 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [14]
  promoter TSS_97 54765 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_98 54884 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_99 55120 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_100 55146 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_101 55785 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_102 (cluster) 55791 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [14]
  promoter TSS_103 (cluster) 55800 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [14]
  promoter TSS_104 55908 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_105 55916 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_106 55920 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_107 56036 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_108 (cluster) 56466 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [14]
  promoter TSS_109 56724 reverse nd [RS-EPT-CBR] [14]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bothmann H., Pluckthun A., 2000, The periplasmic Escherichia coli peptidylprolyl cis,trans-isomerase FkpA. I. Increased functional expression of antibody fragments with and without cis-prolines., J Biol Chem 275(22):17100-5

 [2] Cook GM., Membrillo-Hernandez J., Poole RK., 1997, Transcriptional regulation of the cydDC operon, encoding a heterodimeric ABC transporter required for assembly of cytochromes c and bd in Escherichia coli K-12: regulation by oxygen and alternative electron acceptors., J Bacteriol 179(20):6525-30

 [3] Costello SM., Plummer AM., Fleming PJ., Fleming KG., 2016, Dynamic periplasmic chaperone reservoir facilitates biogenesis of outer membrane proteins., Proc Natl Acad Sci U S A 113(33):E4794-800

 [4] Dartigalongue C., Missiakas D., Raina S., 2001, Characterization of the Escherichia coli sigma E regulon., J Biol Chem 276(24):20866-75

 [5] Ma HW., Buer J., Zeng AP., 2004, Hierarchical structure and modules in the Escherichia coli transcriptional regulatory network revealed by a new top-down approach., BMC Bioinformatics 5:199

 [6] Mogensen JE., Kleinschmidt JH., Schmidt MA., Otzen DE., 2005, Misfolding of a bacterial autotransporter., Protein Sci 14(11):2814-27

 [7] O'Reilly EK., Kreuzer KN., 2004, Isolation of SOS constitutive mutants of Escherichia coli., J Bacteriol 186(21):7149-60

 [8] Pease AJ., Roa BR., Luo W., Winkler ME., 2002, Positive growth rate-dependent regulation of the pdxA, ksgA, and pdxB genes of Escherichia coli K-12., J Bacteriol 184(5):1359-69

 [9] Rouviere PE., De Las Penas A., Mecsas J., Lu CZ., Rudd KE., Gross CA., 1995, rpoE, the gene encoding the second heat-shock sigma factor, sigma E, in Escherichia coli., EMBO J 14(5):1032-42

 [10] Rudd KE., Sofia HJ., Koonin EV., Plunkett G., Lazar S., Rouviere PE., 1995, A new family of peptidyl-prolyl isomerases., Trends Biochem Sci 20(1):12-4

 [11] Vulic M., Kolter R., 2002, Alcohol-induced delay of viability loss in stationary-phase cultures of Escherichia coli., J Bacteriol 184(11):2898-905

 [12] Werner J., Misra R., 2005, YaeT (Omp85) affects the assembly of lipid-dependent and lipid-independent outer membrane proteins of Escherichia coli., Mol Microbiol 57(5):1450-9

 [13] Zhong M., Ferrell B., Lu W., Chai Q., Wei Y., 2013, Insights into the Function and Structural Flexibility of the Periplasmic Molecular Chaperone SurA., J Bacteriol 195(5):1061-7

 [14] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB