RegulonDB RegulonDB 10.9: Gene Form
   

tap gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tar tap cheR

Gene      
Name: tap    Texpresso search in the literature
Synonym(s): ECK1886, EG10987, b1885
Genome position(nucleotides): 1969383 <-- 1970984 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.56
External database links:  
ASAP:
ABE-0006288
CGSC:
123
ECHOBASE:
EB0980
ECOLIHUB:
tap
OU-MICROARRAY:
b1885
STRING:
511145.b1885
COLOMBOS: tap


Product      
Name: methyl-accepting chemotaxis protein Tap
Synonym(s): MCP-IV, Tap, Tap dimer, chemotaxis signaling protein IV, dipeptide chemoreceptor protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 57.512
Isoelectric point: 5.461
Motif(s):
 
Type Positions Sequence
503 -> 503 H
1 -> 168 MFNRIRISTTLFLILILCGILQIGSNGMSFWAFRDDLQRLNQVEQSNQQRAALAQTRAVMLQASTALNKAGTLTALSYPADDIKTLMTTARASLTQSTTLFKSFMAMTAGNEHVRGLQKETEKSFARWHNDLEHQATWLESNQLSDFLTAPVQGSQNAFDVNFEAWQL
189 -> 209 ALVFISMIIVAAIYISSALWW
212 -> 264 KMIVQPLAIIGSHFDSIAAGNLARPIAVYGRNEITAIFASLKTMQQALRGTVS
323 -> 480 SELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIEESVNRVQQGSKLVNNAAATMIDIVSSVTRVNDIMGEIASASEEQQRGIEQVAQAVSQMDQVT

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0004888 - transmembrane signaling receptor activity
biological_process GO:0007165 - signal transduction
GO:0006935 - chemotaxis
External database links:  
DIP:
DIP-10955N
ECOCYC:
TAP-MONOMER
ECOLIWIKI:
b1885
INTERPRO:
IPR003660
INTERPRO:
IPR004089
INTERPRO:
IPR003122
INTERPRO:
IPR004090
INTERPRO:
IPR035440
INTERPRO:
IPR004091
MODBASE:
P07018
PFAM:
PF02203
PFAM:
PF00672
PFAM:
PF00015
PRIDE:
P07018
PRINTS:
PR00260
PRODB:
PRO_000024025
PROSITE:
PS50885
PROSITE:
PS50111
PROSITE:
PS00538
REFSEQ:
NP_416399
SMART:
SM00283
SMART:
SM00319
SMART:
SM00304
SMR:
P07018
SWISSMODEL:
P07018
UNIPROT:
P07018


Operon      
Name: tar-tap-cheRBYZ         
Operon arrangement:
Transcription unit        Promoter
tar-tap-cheRBYZ


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB