RegulonDB RegulonDB 10.8: Gene Form
   

tar gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tar tap cheW C0465 tarp tarp

Gene      
Name: tar    Texpresso search in the literature
Synonym(s): ECK1887, EG10988, b1886, cheM
Genome position(nucleotides): 1971030 <-- 1972691 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.77
External database links:  
ASAP:
ABE-0006290
CGSC:
122
ECHOBASE:
EB0981
OU-MICROARRAY:
b1886
PortEco:
tar
STRING:
511145.b1886
COLOMBOS: tar


Product      
Name: methyl-accepting chemotaxis protein Tar
Synonym(s): CheM, MCP-II, Tar, Tar dimer, aspartate chemoreceptor protein, chemotaxis signaling protein II
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 59.944
Isoelectric point: 5.245
Motif(s):
 
Type Positions Sequence
7 -> 33 VVTLLVMVLGVFALLQLISGSLFFSSL
164 -> 164 A
212 -> 262 IRRMLLTPLAKIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLT
191 -> 211 QWQLAVIALVVVLILLVAWYG
64 -> 73 RINLSRSAVR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0098561 - methyl accepting chemotaxis protein complex
GO:0051286 - cell tip
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0004888 - transmembrane signaling receptor activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0043424 - protein histidine kinase binding
biological_process GO:1901875 - positive regulation of post-translational protein modification
GO:0007172 - signal complex assembly
GO:0007165 - signal transduction
GO:0009593 - detection of chemical stimulus
GO:0006935 - chemotaxis
GO:0050920 - regulation of chemotaxis
GO:0051260 - protein homooligomerization
GO:0071230 - cellular response to amino acid stimulus
External database links:  
DIP:
DIP-10956N
DISPROT:
DP00294
ECOCYC:
TAR-MONOMER
ECOLIWIKI:
b1886
INTERPRO:
IPR004091
INTERPRO:
IPR035440
INTERPRO:
IPR004090
INTERPRO:
IPR004089
INTERPRO:
IPR003660
INTERPRO:
IPR003122
MODBASE:
P07017
PDB:
2ASR
PDB:
2L9G
PDB:
4Z9H
PDB:
4Z9I
PDB:
4Z9J
PFAM:
PF00015
PFAM:
PF02203
PFAM:
PF00672
PRIDE:
P07017
PRINTS:
PR00260
PRODB:
PRO_000024026
PROSITE:
PS50111
PROSITE:
PS50885
PROSITE:
PS00538
REFSEQ:
NP_416400
SMART:
SM00304
SMART:
SM00283
SMART:
SM00319
SMR:
P07017
SWISSMODEL:
P07017
UNIPROT:
P07017


Operon      
Name: tar-tap-cheRBYZ         
Operon arrangement:
Transcription unit        Promoter
tar-tap-cheRBYZ


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB