RegulonDB RegulonDB 10.7: Gene Form
   

tdcA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tdcA tdcB tdcR nc4 TdcR TdcA FNR FNR IHF CRP tdcRp8 tdcRp8 tdcRp7 tdcRp7 tdcRp5 tdcRp5 tdcRp4 tdcRp4 tdcRp6 tdcRp6 tdcAp tdcAp

Gene      
Name: tdcA    Texpresso search in the literature
Synonym(s): ECK3107, EG10989, b3118
Genome position(nucleotides): 3266127 <-- 3267065 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.17
External database links:  
ASAP:
ABE-0010252
CGSC:
29702
ECHOBASE:
EB0982
OU-MICROARRAY:
b3118
PORTECO:
tdcA
REGULONDB:
b3118
STRING:
511145.b3118
M3D: tdcA
COLOMBOS: tdcA
PortEco: b3118


Product      
Name: DNA-binding transcriptional activator TdcA
Synonym(s): TdcA, transcriptional activator of tdc operon
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 34.539
Isoelectric point: 5.219
Motif(s):
 
Type Positions Sequence
3 -> 3 T
10 -> 68 QHLVVFQEVIRSGSIGSAAKELGLTQPAVSKIINDIEDYFGVELVVRKNTGVTLTPAGQ
98 -> 296 EVSFGFPSLIGFTFMSGMINKFKEVFPKAQVSMYEAQLSSFLPAIRDGRLDFAIGTLSAEMKLQDLHVEPLFESEFVLVASKSRTCTGTTTLESLKNEQWVLPQTNMGYYSELLTTLQRNGISIENIVKTDSVVTIYNLVLNADFLTVIPCDMTSPFGSNQFITIPVEETLPVAQYAAVWSKNYRIKKAASVLVELAKE
24 -> 43 IGSAAKELGLTQPAVSKIIN
7 -> 64 PKTQHLVVFQEVIRSGSIGSAAKELGLTQPAVSKIINDIEDYFGVELVVRKNTGVTLT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0070689 - L-threonine catabolic process to propionate
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Ganduri YL., et al., 1993
[2] Goss TJ., et al., 1985
[3] Hagewood BT., et al., 1994
[4] Rodrigues GA., et al., 1993
[5] Schweizer HP., et al., 1989
External database links:  
DIP:
DIP-10968N
ECOCYC:
PD00268
ECOLIWIKI:
b3118
INTERPRO:
IPR000847
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR005119
MINT:
MINT-1310858
MODBASE:
P0ACQ7
PFAM:
PF03466
PFAM:
PF00126
PRIDE:
P0ACQ7
PRINTS:
PR00039
PRODB:
PRO_000024037
PROSITE:
PS50931
PROTEINMODELPORTAL:
P0ACQ7
REFSEQ:
NP_417588
SMR:
P0ACQ7
UNIPROT:
P0ACQ7


Operon      
Name: tdcABCDEFG         
Operon arrangement:
Transcription unit        Promoter
tdcABCDEFG
tdcBCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: TdcA, CRP, TdcR, FNR, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tdcRp6 3267190 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter tdcRp4 3267221 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter tdcRp5 3267226 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter tdcRp7 3267228 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter tdcRp8 3267254 forward Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Ganduri YL., Sadda SR., Datta MW., Jambukeswaran RK., Datta P., 1993, TdcA, a transcriptional activator of the tdcABC operon of Escherichia coli, is a member of the LysR family of proteins., Mol Gen Genet 240(3):395-402

 [2] Goss TJ., Datta P., 1985, Molecular cloning and expression of the biodegradative threonine dehydratase gene (tdc) of Escherichia coli K12., Mol Gen Genet 201(2):308-14

 [3] Hagewood BT., Ganduri YL., Datta P., 1994, Functional analysis of the tdcABC promoter of Escherichia coli: roles of TdcA and TdcR., J Bacteriol 176(20):6214-20

 [4] Rodrigues GA., Park M., 1993, Dimerization mediated through a leucine zipper activates the oncogenic potential of the met receptor tyrosine kinase., Mol Cell Biol 13(11):6711-22

 [5] Schweizer HP., Datta P., 1989, The complete nucleotide sequence of the tdc region of Escherichia coli., Nucleic Acids Res 17(10):3994

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB