RegulonDB RegulonDB 9.2: Gene Form
   

tdk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

adhE tdk ychG_2 hns ychG_1 Fis Fis H-NS Fis Fis H-NS Fis H-NS Fis Fis DsrA terminator TSS_1617 TSS_1617 TSS_1616 TSS_1616 TSS_1615 TSS_1615 TSS_1614 (cluster) TSS_1614 (cluster) TSS_1613 TSS_1613 TSS_1612 TSS_1612 TSS_1611 TSS_1611 TSS_1610 TSS_1610 TSS_1609 (cluster) TSS_1609 (cluster) TSS_1608 TSS_1608 TSS_1607 TSS_1607 TSS_1606 TSS_1606 TSS_1605 TSS_1605 TSS_1604 TSS_1604 TSS_1603 TSS_1603 TSS_1602 TSS_1602 TSS_1601 (cluster) TSS_1601 (cluster) TSS_1600 TSS_1600 TSS_1599 (cluster) TSS_1599 (cluster) TSS_1598 TSS_1598 TSS_1597 TSS_1597 TSS_1596 TSS_1596 TSS_1595 TSS_1595 TSS_1594 TSS_1594 TSS_1593 TSS_1593 TSS_1592 TSS_1592 TSS_1591 TSS_1591 TSS_1590 TSS_1590 TSS_1589 TSS_1589 TSS_1588 TSS_1588 TSS_1587 TSS_1587 TSS_1586 TSS_1586 TSS_1585 TSS_1585 TSS_1584 TSS_1584 TSS_1583 TSS_1583 TSS_1582 TSS_1582 TSS_1581 TSS_1581 TSS_1580 TSS_1580 TSS_1579 TSS_1579 TSS_1578 TSS_1578 TSS_1577 TSS_1577 tdkp1 tdkp1 tdkp8 tdkp8 hnsp hnsp TSS_1575 TSS_1575 TSS_1574 TSS_1574 TSS_1573 TSS_1573 TSS_1572 (cluster) TSS_1572 (cluster) TSS_1571 TSS_1571 TSS_1570 TSS_1570 TSS_1569 TSS_1569

Gene      
Name: tdk    Texpresso search in the literature
Synonym(s): b1238
Genome position(nucleotides): 1293527 --> 1294144 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.32
External database links:  
ECOCYC:
EG10994
GENBANK:
1787490
GENBANK_RefSeq:
16129199
OU-MICROARRAY:
b1238
M3D: tdk
COLOMBOS: tdk
PortEco: b1238


Product      
Name: thymidine kinase/deoxyuridine kinase
Synonym(s): Tdk
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.457
Isoelectric point: 11.82
Motif(s):
 
Type Positions Sequence
2 -> 186 NIPVFRRYTSSQI**RLMLSVYGKVALGKQKIRPQKGNAVHLRGAALCFTG*RVFDILTDLGLDGRGRFVMNTTSRAPRRCSSRFGMVPGDAVFPSSIISDAIFFHAGSSQWRLQPFWFSVSSRSSL*KSLSNNVIELSGMVASMEWASTVSLCR*GAVTAFSRM*LPRFIKATRRITG*AFCRL
9 -> 16 YTSSQI**
87 -> 90 GMVP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008270 - zinc ion binding
GO:0004797 - thymidine kinase activity
biological_process GO:0008152 - metabolic process
GO:0006259 - DNA metabolic process
GO:0016310 - phosphorylation
GO:0009157 - deoxyribonucleoside monophosphate biosynthetic process
GO:0071897 - DNA biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
TDK-MONOMER
EXPASY:
EC-2.7.1.145
GENPROTEC:
b1238


Operon      
Name: tdk         
Operon arrangement:
Transcription unit        Promoter
tdk


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1569 1292735 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1570 1292806 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1571 1292820 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1572 (cluster) 1292827 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1573 1292931 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1574 1292937 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1575 1292942 reverse nd [RS-EPT-CBR] [1]
  promoter tdkp8 1293493 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter tdkp1 1293516 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1577 1295543 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1578 1295679 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1579 1295919 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1580 1296310 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1581 1296316 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1582 1296554 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1583 1296583 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1584 1296586 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1585 1296589 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1586 1296611 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1587 1296616 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1588 1296672 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1589 1296674 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1590 1296756 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1591 1296775 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1592 1296797 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1593 1296870 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1594 1296892 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1595 1296896 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1596 1297024 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1597 1297170 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1598 1297212 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1599 (cluster) 1297288 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1600 1297462 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1601 (cluster) 1297466 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1602 1297601 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1603 1297609 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1604 1297628 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1605 1297669 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1606 1297682 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1607 1297691 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1608 1297717 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1609 (cluster) 1297803 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1610 1297806 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1611 1297812 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1612 1297840 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1613 1297873 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1614 (cluster) 1297877 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1615 1298092 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1616 1298104 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1617 1298113 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol. 333(2):261-78


RegulonDB