RegulonDB RegulonDB 9.1: Gene Form
   

tdk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

adhE tdk ychG_2 hns ychG_1 Fis Fis H-NS Fis Fis H-NS Fis H-NS Fis Fis DsrA terminator TSS_1617 TSS_1617 TSS_1616 TSS_1616 TSS_1615 TSS_1615 TSS_1614 (cluster) TSS_1614 (cluster) TSS_1613 TSS_1613 TSS_1612 TSS_1612 TSS_1611 TSS_1611 TSS_1610 TSS_1610 TSS_1609 (cluster) TSS_1609 (cluster) TSS_1608 TSS_1608 TSS_1607 TSS_1607 TSS_1606 TSS_1606 TSS_1605 TSS_1605 TSS_1604 TSS_1604 TSS_1603 TSS_1603 TSS_1602 TSS_1602 TSS_1601 (cluster) TSS_1601 (cluster) TSS_1600 TSS_1600 TSS_1599 (cluster) TSS_1599 (cluster) TSS_1598 TSS_1598 TSS_1597 TSS_1597 TSS_1596 TSS_1596 TSS_1595 TSS_1595 TSS_1594 TSS_1594 TSS_1593 TSS_1593 TSS_1592 TSS_1592 TSS_1591 TSS_1591 TSS_1590 TSS_1590 TSS_1589 TSS_1589 TSS_1588 TSS_1588 TSS_1587 TSS_1587 TSS_1586 TSS_1586 TSS_1585 TSS_1585 TSS_1584 TSS_1584 TSS_1583 TSS_1583 TSS_1582 TSS_1582 TSS_1581 TSS_1581 TSS_1580 TSS_1580 TSS_1579 TSS_1579 TSS_1578 TSS_1578 TSS_1577 TSS_1577 tdkp1 tdkp1 tdkp8 tdkp8 hnsp hnsp TSS_1575 TSS_1575 TSS_1574 TSS_1574 TSS_1573 TSS_1573 TSS_1572 (cluster) TSS_1572 (cluster) TSS_1571 TSS_1571 TSS_1570 TSS_1570 TSS_1569 TSS_1569

Gene      
Name: tdk    Texpresso search in the literature
Synonym(s): b1238
Genome position(nucleotides): 1292750 --> 1293367 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.23
External database links:  
ECOCYC:
EG10994
GENBANK:
1787490
GENBANK_RefSeq:
16129199
OU-MICROARRAY:
b1238
M3D: tdk
COLOMBOS: tdk
PortEco: b1238


Product      
Name: thymidine kinase/deoxyuridine kinase
Synonym(s): Tdk
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.457
Isoelectric point: 6.35
Motif(s):
 
Type Positions Sequence
2 -> 186 AQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAKLFNQNSSLFDEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVSVCRKHY
9 -> 16 SAMNAGKS
87 -> 90 DECQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008270 - zinc ion binding
GO:0004797 - thymidine kinase activity
biological_process GO:0008152 - metabolic process
GO:0006259 - DNA metabolic process
GO:0016310 - phosphorylation
GO:0009157 - deoxyribonucleoside monophosphate biosynthetic process
GO:0071897 - DNA biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
TDK-MONOMER
EXPASY:
EC-2.7.1.145
GENPROTEC:
b1238


Operon      
Name: tdk         
Operon arrangement:
Transcription unit        Promoter
tdk


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1569 1291958 reverse nd nd nd
  promoter TSS_1570 1292029 reverse nd nd nd
  promoter TSS_1571 1292043 reverse nd nd nd
  promoter TSS_1572 (cluster) 1292050 reverse For this promoter, there
Read more >
nd nd
  promoter TSS_1573 1292154 reverse nd nd nd
  promoter TSS_1574 1292160 reverse nd nd nd
  promoter TSS_1575 1292165 reverse nd nd nd
  promoter tdkp8 1292716 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter tdkp1 1292739 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1577 1294766 reverse nd nd nd
  promoter TSS_1578 1294902 reverse nd nd nd
  promoter TSS_1579 1295142 reverse nd nd nd
  promoter TSS_1580 1295533 reverse nd nd nd
  promoter TSS_1581 1295539 reverse nd nd nd
  promoter TSS_1582 1295777 reverse nd nd nd
  promoter TSS_1583 1295806 reverse nd nd nd
  promoter TSS_1584 1295809 reverse nd nd nd
  promoter TSS_1585 1295812 reverse nd nd nd
  promoter TSS_1586 1295834 reverse nd nd nd
  promoter TSS_1587 1295839 reverse nd nd nd
  promoter TSS_1588 1295895 reverse nd nd nd
  promoter TSS_1589 1295897 reverse nd nd nd
  promoter TSS_1590 1295979 reverse nd nd nd
  promoter TSS_1591 1295998 reverse nd nd nd
  promoter TSS_1592 1296020 reverse nd nd nd
  promoter TSS_1593 1296093 reverse nd nd nd
  promoter TSS_1594 1296115 reverse nd nd nd
  promoter TSS_1595 1296119 reverse nd nd nd
  promoter TSS_1596 1296247 reverse nd nd nd
  promoter TSS_1597 1296393 reverse nd nd nd
  promoter TSS_1598 1296435 reverse nd nd nd
  promoter TSS_1599 (cluster) 1296511 reverse For this promoter, there
Read more >
nd nd
  promoter TSS_1600 1296685 reverse nd nd nd
  promoter TSS_1601 (cluster) 1296689 reverse For this promoter, there
Read more >
nd nd
  promoter TSS_1602 1296824 reverse nd nd nd
  promoter TSS_1603 1296832 reverse nd nd nd
  promoter TSS_1604 1296851 reverse nd nd nd
  promoter TSS_1605 1296892 reverse nd nd nd
  promoter TSS_1606 1296905 reverse nd nd nd
  promoter TSS_1607 1296914 reverse nd nd nd
  promoter TSS_1608 1296940 reverse nd nd nd
  promoter TSS_1609 (cluster) 1297026 reverse For this promoter, there
Read more >
nd nd
  promoter TSS_1610 1297029 reverse nd nd nd
  promoter TSS_1611 1297035 reverse nd nd nd
  promoter TSS_1612 1297063 reverse nd nd nd
  promoter TSS_1613 1297096 reverse nd nd nd
  promoter TSS_1614 (cluster) 1297100 reverse For this promoter, there
Read more >
nd nd
  promoter TSS_1615 1297315 reverse nd nd nd
  promoter TSS_1616 1297327 reverse nd nd nd
  promoter TSS_1617 1297336 reverse nd nd nd


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol. 333(2):261-78


RegulonDB