RegulonDB RegulonDB 10.8: Gene Form
   

tesB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

amtB tesB ybaY ybaYp3 ybaYp3 tesBp tesBp

Gene      
Name: tesB    Texpresso search in the literature
Synonym(s): ECK0446, EG10995, b0452
Genome position(nucleotides): 474301 <-- 475161 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.5
External database links:  
ASAP:
ABE-0001566
CGSC:
17581
ECHOBASE:
EB0988
OU-MICROARRAY:
b0452
PortEco:
tesB
STRING:
511145.b0452
COLOMBOS: tesB


Product      
Name: acyl-CoA thioesterase II
Synonym(s): TesB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.966
Isoelectric point: 6.649
Motif(s):
 
Type Positions Sequence
2 -> 286 SQALKNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALYAAKETVPEERLVHSFHSYFLRPGDSKKPIIYDVETLRDGNSFSARRVAAIQNGKPIFYMTASFQAPEAGFEHQKTMPSAPAPDGLPSETQIAQSLAHLLPPVLKDKFICDRPLEVRPVEFHNPLKGHVAEPHRQVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEPGIQIATIDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGVMRNHN
33 -> 282 QVFGGQVVGQALYAAKETVPEERLVHSFHSYFLRPGDSKKPIIYDVETLRDGNSFSARRVAAIQNGKPIFYMTASFQAPEAGFEHQKTMPSAPAPDGLPSETQIAQSLAHLLPPVLKDKFICDRPLEVRPVEFHNPLKGHVAEPHRQVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEPGIQIATIDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGVM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0047617 - acyl-CoA hydrolase activity
biological_process GO:0009062 - fatty acid catabolic process
GO:0006637 - acyl-CoA metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Liu Q., et al., 2007
External database links:  
DIP:
DIP-10980N
ECOCYC:
THIOESTERII-MONOMER
ECOLIWIKI:
b0452
INTERPRO:
IPR029069
INTERPRO:
IPR003703
PANTHER:
PTHR11066
PDB:
1C8U
PFAM:
PF13622
PRIDE:
P0AGG2
PRODB:
PRO_000024049
REFSEQ:
NP_414986
SMR:
P0AGG2
SWISSMODEL:
P0AGG2
UNIPROT:
P0AGG2


Operon      
Name: tesB         
Operon arrangement:
Transcription unit        Promoter
tesB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybaYp3 475245 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Liu Q., Ouyang SP., Chung A., Wu Q., Chen GQ., 2007, Microbial production of R-3-hydroxybutyric acid by recombinant E. coli harboring genes of phbA, phbB, and tesB., Appl Microbiol Biotechnol 76(4):811-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB