RegulonDB RegulonDB 10.7: Gene Form
   

thrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thrA thrB thrL Cis-reg; leader terminator anti-terminator anti-anti-terminator TSS_15 TSS_15 TSS_14 TSS_14 TSS_13 TSS_13 TSS_12 TSS_12 TSS_11 TSS_11 TSS_10 TSS_10 TSS_9 TSS_9 TSS_8 TSS_8 TSS_7 TSS_7 TSS_6 TSS_6 TSS_5 TSS_5 TSS_4 TSS_4 TSS_3 (cluster) TSS_3 (cluster)

Gene      
Name: thrA    Texpresso search in the literature
Synonym(s): ECK0002, EG10998, Hs, b0002, thrA1, thrA2, thrD
Genome position(nucleotides): 337 --> 2799 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.07
External database links:  
ASAP:
ABE-0000008
CGSC:
111
ECHOBASE:
EB0991
OU-MICROARRAY:
b0002
PORTECO:
thrA
REGULONDB:
b0002
STRING:
511145.b0002
M3D: thrA
COLOMBOS: thrA
PortEco: b0002


Product      
Name: fused aspartate kinase/homoserine dehydrogenase 1
Synonym(s): ThrA, ThrD
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 89.12
Isoelectric point: 5.385
Motif(s):
 
Type Positions Sequence
1 -> 249 MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDALPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINAALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIPADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQVPDARLLKSM
2 -> 284 RVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDALPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINAALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIPADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKN
250 -> 470 SYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRDEDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISFCVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFV
324 -> 376 GMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISFCVPQSDCVRAERAMQE
607 -> 607 T

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.21 - homoserine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.7 - lysine
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016491 - oxidoreductase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004072 - aspartate kinase activity
GO:0004412 - homoserine dehydrogenase activity
GO:0050661 - NADP binding
biological_process GO:0008152 - metabolic process
GO:0006520 - cellular amino acid metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009067 - aspartate family amino acid biosynthetic process
GO:0009088 - threonine biosynthetic process
GO:0009089 - lysine biosynthetic process via diaminopimelate
GO:0009090 - homoserine biosynthetic process
GO:0016310 - phosphorylation
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-2907N
ECOCYC:
ASPKINIHOMOSERDEHYDROGI-MONOMER
ECOLIWIKI:
b0002
INTERPRO:
IPR002912
INTERPRO:
IPR036393
INTERPRO:
IPR001048
INTERPRO:
IPR001341
INTERPRO:
IPR001342
INTERPRO:
IPR041743
INTERPRO:
IPR005106
INTERPRO:
IPR011147
INTERPRO:
IPR018042
INTERPRO:
IPR019811
INTERPRO:
IPR027795
INTERPRO:
IPR036291
MINT:
MINT-1288804
MODBASE:
P00561
PDB:
6MX1
PFAM:
PF01842
PFAM:
PF13840
PFAM:
PF03447
PFAM:
PF00742
PFAM:
PF00696
PRIDE:
P00561
PRODB:
PRO_000024066
PROSITE:
PS00324
PROSITE:
PS01042
PROSITE:
PS51671
PROTEINMODELPORTAL:
P00561
REFSEQ:
NP_414543
SMR:
P00561
UNIPROT:
P00561


Operon      
Name: thrLABC         
Operon arrangement:
Transcription unit        Promoter
thrL
thrLABC


RNA cis-regulatory element    
Attenuation: Transcriptional
   
Cis-reg; leader Threonine operon leader
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3 (cluster) 683 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4 688 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5 703 forward nd [RS-EPT-CBR] [1]
  promoter TSS_6 1009 forward nd [RS-EPT-CBR] [1]
  promoter TSS_7 1176 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_8 1886 forward nd [RS-EPT-CBR] [1]
  promoter TSS_9 1965 forward nd [RS-EPT-CBR] [1]
  promoter TSS_10 2581 forward nd [RS-EPT-CBR] [1]
  promoter TSS_11 2811 forward nd [RS-EPT-CBR] [1]
  promoter TSS_12 3066 forward nd [RS-EPT-CBR] [1]
  promoter TSS_13 3368 forward nd [RS-EPT-CBR] [1]
  promoter TSS_14 3396 forward nd [RS-EPT-CBR] [1]
  promoter TSS_15 3401 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB