RegulonDB RegulonDB 10.7: Gene Form
   

thrB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thrA thrC thrB anti-anti-terminator anti-terminator TSS_16 TSS_16 TSS_15 TSS_15 TSS_14 TSS_14 TSS_13 TSS_13 TSS_12 TSS_12 TSS_11 TSS_11 TSS_10 TSS_10 TSS_9 TSS_9 TSS_8 TSS_8 TSS_7 TSS_7 TSS_6 TSS_6 TSS_5 TSS_5 TSS_4 TSS_4 TSS_3 (cluster) TSS_3 (cluster)

Gene      
Name: thrB    Texpresso search in the literature
Synonym(s): ECK0003, EG10999, b0003
Genome position(nucleotides): 2801 --> 3733 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.27
External database links:  
ASAP:
ABE-0000010
CGSC:
110
ECHOBASE:
EB0992
OU-MICROARRAY:
b0003
PORTECO:
thrB
REGULONDB:
b0003
STRING:
511145.b0003
M3D: thrB
COLOMBOS: thrB
PortEco: b0003


Product      
Name: homoserine kinase
Synonym(s): ThrB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.624
Isoelectric point: 5.397
Motif(s):
 
Type Positions Sequence
85 -> 150 TLEKNMPIGSGLGSSACSVVAALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGG
206 -> 206 H
212 -> 281 HACYSRQPELAAKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPETAQRVAD
91 -> 101 PIGSGLGSSAC
139 -> 139 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.8 - threonine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004413 - homoserine kinase activity
biological_process GO:0006566 - threonine metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009088 - threonine biosynthetic process
GO:0016310 - phosphorylation
External database links:  
ECOCYC:
HOMOSERKIN-MONOMER
ECOLIWIKI:
b0003
INTERPRO:
IPR020568
INTERPRO:
IPR036554
INTERPRO:
IPR014721
INTERPRO:
IPR000870
INTERPRO:
IPR006203
INTERPRO:
IPR006204
INTERPRO:
IPR013750
MODBASE:
P00547
PANTHER:
PTHR20861:SF1
PFAM:
PF00288
PFAM:
PF08544
PRIDE:
P00547
PRINTS:
PR00958
PRODB:
PRO_000024067
PROSITE:
PS00627
PROTEINMODELPORTAL:
P00547
REFSEQ:
NP_414544
SMR:
P00547
UNIPROT:
P00547


Operon      
Name: thrLABC         
Operon arrangement:
Transcription unit        Promoter
thrL
thrLABC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3 (cluster) 683 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4 688 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5 703 forward nd [RS-EPT-CBR] [1]
  promoter TSS_6 1009 forward nd [RS-EPT-CBR] [1]
  promoter TSS_7 1176 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_8 1886 forward nd [RS-EPT-CBR] [1]
  promoter TSS_9 1965 forward nd [RS-EPT-CBR] [1]
  promoter TSS_10 2581 forward nd [RS-EPT-CBR] [1]
  promoter TSS_11 2811 forward nd [RS-EPT-CBR] [1]
  promoter TSS_12 3066 forward nd [RS-EPT-CBR] [1]
  promoter TSS_13 3368 forward nd [RS-EPT-CBR] [1]
  promoter TSS_14 3396 forward nd [RS-EPT-CBR] [1]
  promoter TSS_15 3401 forward nd [RS-EPT-CBR] [1]
  promoter TSS_16 4241 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB