RegulonDB RegulonDB 10.7: Gene Form
   

thrC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thrC thrB yaaX terminator anti-anti-terminator anti-terminator yaaXp4 yaaXp4 TSS_16 TSS_16 TSS_15 TSS_15 TSS_14 TSS_14 TSS_13 TSS_13 TSS_12 TSS_12 TSS_11 TSS_11

Gene      
Name: thrC    Texpresso search in the literature
Synonym(s): ECK0004, EG11000, b0004
Genome position(nucleotides): 3734 --> 5020 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.84
External database links:  
ASAP:
ABE-0000012
CGSC:
109
ECHOBASE:
EB0993
OU-MICROARRAY:
b0004
PORTECO:
thrC
REGULONDB:
b0004
STRING:
511145.b0004
M3D: thrC
COLOMBOS: thrC
PortEco: b0004


Product      
Name: threonine synthase
Synonym(s): ThrC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 47.114
Isoelectric point: 5.067
Motif(s):
 
Type Positions Sequence
99 -> 369 FHGPTLAFKDFGGRFMAQMLTHIAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNAMDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRALRDQLNPGE
8 -> 80 DHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILSAFIGDEIPQEILEERVRAAF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.8 - threonine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0030170 - pyridoxal phosphate binding
GO:0004795 - threonine synthase activity
biological_process GO:0006520 - cellular amino acid metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009088 - threonine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10993N
ECOCYC:
THRESYN-MONOMER
ECOLIWIKI:
b0004
INTERPRO:
IPR000634
INTERPRO:
IPR037158
INTERPRO:
IPR001926
INTERPRO:
IPR004450
INTERPRO:
IPR029144
INTERPRO:
IPR036052
MODBASE:
P00934
PDB:
1VB3
PFAM:
PF00291
PFAM:
PF14821
PRIDE:
P00934
PRODB:
PRO_000024068
PROSITE:
PS00165
PROTEINMODELPORTAL:
P00934
REFSEQ:
NP_414545
SMR:
P00934
UNIPROT:
P00934


Operon      
Name: thrLABC         
Operon arrangement:
Transcription unit        Promoter
thrL
thrLABC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_11 2811 forward nd [RS-EPT-CBR] [1]
  promoter TSS_12 3066 forward nd [RS-EPT-CBR] [1]
  promoter TSS_13 3368 forward nd [RS-EPT-CBR] [1]
  promoter TSS_14 3396 forward nd [RS-EPT-CBR] [1]
  promoter TSS_15 3401 forward nd [RS-EPT-CBR] [1]
  promoter TSS_16 4241 forward nd [RS-EPT-CBR] [1]
  promoter yaaXp4 5030 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB