RegulonDB RegulonDB 10.7: Gene Form
   

tolB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tolB tolA pal terminator anti-terminator anti-anti-terminator TSS_896 TSS_896 TSS_895 TSS_895 TSS_894 TSS_894 TSS_893 TSS_893 TSS_892 TSS_892 TSS_891 TSS_891 tolBp3 tolBp3 tolBp6 tolBp6 TSS_890 (cluster) TSS_890 (cluster)

Gene      
Name: tolB    Texpresso search in the literature
Synonym(s): ECK0729, EG11008, b0740, lky, lkyA, tol-3
Genome position(nucleotides): 777740 --> 779032 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.13
Reference(s): [1] Levengood SK., et al., 1989
External database links:  
ASAP:
ABE-0002517
CGSC:
98
ECHOBASE:
EB1001
OU-MICROARRAY:
b0740
PORTECO:
tolB
REGULONDB:
b0740
STRING:
511145.b0740
M3D: tolB
COLOMBOS: tolB
PortEco: b0740


Product      
Name: Tol-Pal system periplasmic protein TolB
Synonym(s): Lky, LkyA, TolB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 45.956
Isoelectric point: 7.834
Motif(s):
 
Type Positions Sequence
166 -> 200 RIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQ
246 -> 286 NGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDG
141 -> 155 LRYAGHTASDEVFEK
290 -> 330 NTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWE
377 -> 418 DETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATD

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.4 - colicin related
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0032991 - protein-containing complex
GO:0032153 - cell division site
molecular_function GO:0019904 - protein domain specific binding
GO:0005515 - protein binding
GO:0044877 - protein-containing complex binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0015031 - protein transport
GO:0017038 - protein import
GO:0043213 - bacteriocin transport
GO:0071237 - cellular response to bacteriocin
Note(s): Note(s): ...[more].
Reference(s): [2] Benedetti H., et al., 1991
[3] Bouveret E., et al., 1998
[4] Duche D., et al., 2006
[5] Housden NG., et al., 2013
[6] Loftus SR., et al., 2006
[7] McBroom AJ., et al., 2006
External database links:  
DIP:
DIP-48262N
ECOCYC:
EG11008-MONOMER
ECOLIWIKI:
b0740
INTERPRO:
IPR011042
INTERPRO:
IPR011659
INTERPRO:
IPR014167
INTERPRO:
IPR036752
INTERPRO:
IPR007195
MINT:
P0A855
MODBASE:
P0A855
PDB:
3IAX
PDB:
2W8B
PDB:
2IVZ
PDB:
2HQS
PDB:
1CRZ
PDB:
1C5K
PFAM:
PF04052
PFAM:
PF07676
PRIDE:
P0A855
PRODB:
PRO_000024079
PROTEINMODELPORTAL:
P0A855
REFSEQ:
NP_415268
SMR:
P0A855
UNIPROT:
P0A855


Operon      
Name: tolB-pal-cpoB         
Operon arrangement:
Transcription unit        Promoter
tolB-pal-ybgF
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_890 (cluster) 777229 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter tolBp6 777537 forward Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter tolBp3 777560 forward Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter TSS_891 777769 forward nd [RS-EPT-CBR] [8]
  promoter TSS_892 778129 forward nd [RS-EPT-CBR] [8]
  promoter TSS_893 778824 forward nd [RS-EPT-CBR] [8]
  promoter TSS_894 778979 forward nd [RS-EPT-CBR] [8]
  promoter TSS_895 779058 forward nd [RS-EPT-CBR] [8]
  promoter TSS_896 779365 forward nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Levengood SK., Webster RE., 1989, Nucleotide sequences of the tolA and tolB genes and localization of their products, components of a multistep translocation system in Escherichia coli., J Bacteriol 171(12):6600-9

 [2] Benedetti H., Frenette M., Baty D., Knibiehler M., Pattus F., Lazdunski C., 1991, Individual domains of colicins confer specificity in colicin uptake, in pore-properties and in immunity requirement., J Mol Biol 217(3):429-39

 [3] Bouveret E., Rigal A., Lazdunski C., Benedetti H., 1998, Distinct regions of the colicin A translocation domain are involved in the interaction with TolA and TolB proteins upon import into Escherichia coli., Mol Microbiol 27(1):143-57

 [4] Duche D., Frenkian A., Prima V., Lloubes R., 2006, Release of immunity protein requires functional endonuclease colicin import machinery., J Bacteriol 188(24):8593-600

 [5] Housden NG., Hopper JT., Lukoyanova N., Rodriguez-Larrea D., Wojdyla JA., Klein A., Kaminska R., Bayley H., Saibil HR., Robinson CV., Kleanthous C., 2013, Intrinsically disordered protein threads through the bacterial outer-membrane porin OmpF., Science 340(6140):1570-4

 [6] Loftus SR., Walker D., Mate MJ., Bonsor DA., James R., Moore GR., Kleanthous C., 2006, Competitive recruitment of the periplasmic translocation portal TolB by a natively disordered domain of colicin E9., Proc Natl Acad Sci U S A 103(33):12353-8

 [7] McBroom AJ., Johnson AP., Vemulapalli S., Kuehn MJ., 2006, Outer membrane vesicle production by Escherichia coli is independent of membrane instability., J Bacteriol 188(15):5385-92

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [9] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB