RegulonDB RegulonDB 10.7: Gene Form
   

tolQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tolQ tolR ybgC ybgE TSS_889 TSS_889 ybgCp5 ybgCp5 ybgCp6 ybgCp6

Gene      
Name: tolQ    Texpresso search in the literature
Synonym(s): ECK0726, EG11010, b0737, fii, tolP
Genome position(nucleotides): 775153 --> 775845 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.51
External database links:  
ASAP:
ABE-0002511
CGSC:
17815
ECHOBASE:
EB1003
OU-MICROARRAY:
b0737
PORTECO:
tolQ
REGULONDB:
b0737
STRING:
511145.b0737
M3D: tolQ
COLOMBOS: tolQ
PortEco: b0737


Product      
Name: Tol-Pal system protein TolQ
Synonym(s): Fii, TolP, TolQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 25.598
Isoelectric point: 7.088
Motif(s):
 
Type Positions Sequence
9 -> 36 LFLKASLLVKLIMLILIGFSIASWAIII
20 -> 37 IMLILIGFSIASWAIIIQ
177 -> 177 A
192 -> 230 YNRLNQRVNKLELNYDNFMEEFTAILHRQAFTVSESNKG
1 -> 8 MTDMNILD

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.4 - colicin related
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030313 - cell envelope
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0017038 - protein import
GO:0043213 - bacteriocin transport
Note(s): Note(s): ...[more].
Reference(s): [1] Braun V., et al., 2004
[2] Guihard G., et al., 1994
External database links:  
DIP:
DIP-11008N
ECOCYC:
EG11010-MONOMER
ECOLIWIKI:
b0737
INTERPRO:
IPR002898
INTERPRO:
IPR014163
PFAM:
PF01618
PRIDE:
P0ABU9
PRODB:
PRO_000024081
PROTEINMODELPORTAL:
P0ABU9
REFSEQ:
NP_415265
SMR:
P0ABU9
UNIPROT:
P0ABU9


Operon      
Name: ybgC-tolQRA         
Operon arrangement:
Transcription unit        Promoter
ybgC-tolQRA
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybgCp6 774644 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ybgCp5 774709 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_889 774711 forward nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Braun V., Herrmann C., 2004, Point mutations in transmembrane helices 2 and 3 of ExbB and TolQ affect their activities in Escherichia coli K-12., J Bacteriol 186(13):4402-6

 [2] Guihard G., Boulanger P., Benedetti H., Lloubes R., Besnard M., Letellier L., 1994, Colicin A and the Tol proteins involved in its translocation are preferentially located in the contact sites between the inner and outer membranes of Escherichia coli cells., J Biol Chem 269(8):5874-80

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB