RegulonDB RegulonDB 10.7: Gene Form
   

tolR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tolA tolQ tolR ybgC anti-anti-terminator tolBp3 tolBp3 tolBp6 tolBp6 TSS_890 (cluster) TSS_890 (cluster)

Gene      
Name: tolR    Texpresso search in the literature
Synonym(s): ECK0727, EG11011, b0738
Genome position(nucleotides): 775849 --> 776277 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.75
External database links:  
ASAP:
ABE-0002513
CGSC:
17812
ECHOBASE:
EB1004
OU-MICROARRAY:
b0738
PORTECO:
tolR
REGULONDB:
b0738
STRING:
511145.b0738
M3D: tolR
COLOMBOS: tolR
PortEco: b0738


Product      
Name: Tol-Pal system protein TolR
Synonym(s): TolR
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 15.383
Isoelectric point: 5.207
Motif(s):
 
Type Positions Sequence
10 -> 141 RDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEVDLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPKTVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQP
41 -> 142 QSVEVDLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPKTVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI
117 -> 142 YDEIIKALNLLHSAGVKSVGLMTQPI
1 -> 43 MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSV
44 -> 142 EVDLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPKTVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0015031 - protein transport
GO:0043213 - bacteriocin transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Miyazaki K., et al., 1985
[2] Sun TP., et al., 1987
[3] Zhang XY., et al., 2009
External database links:  
DIP:
DIP-48143N
ECOCYC:
EG11011-MONOMER
ECOLIWIKI:
b0738
INTERPRO:
IPR003400
INTERPRO:
IPR014168
PANTHER:
PTHR30558
PDB:
5BY4
PFAM:
PF02472
PRIDE:
P0ABV6
PRODB:
PRO_000024082
PROTEINMODELPORTAL:
P0ABV6
REFSEQ:
NP_415266
SMR:
P0ABV6
UNIPROT:
P0ABV6


Operon      
Name: ybgC-tolQRA         
Operon arrangement:
Transcription unit        Promoter
ybgC-tolQRA
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_890 (cluster) 777229 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter tolBp6 777537 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter tolBp3 777560 forward Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Miyazaki K., Mashima K., Yamashita N., Yamashita J., Horio T., 1985, Characterization of a growth-inhibiting protein present in rat serum that exerts a differential effect on in vitro growth of nonmalignant rat liver cells when compared with Rous sarcoma virus-transformed rat liver cells., In Vitro Cell Dev Biol 21(1):62-6

 [2] Sun TP., Webster RE., 1987, Nucleotide sequence of a gene cluster involved in entry of E colicins and single-stranded DNA of infecting filamentous bacteriophages into Escherichia coli., J Bacteriol 169(6):2667-74

 [3] Zhang XY., Goemaere EL., Thome R., Gavioli M., Cascales E., Lloubes R., 2009, Mapping the Interactions between Escherichia coli Tol Subunits: ROTATION OF THE TolR TRANSMEMBRANE HELIX., J Biol Chem 284(7):4275-82

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB