RegulonDB RegulonDB 10.9: Gene Form
   

tpiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tpiA cdh yiiQ Cra TSS_4619 (cluster) TSS_4619 (cluster) tpiAp2 tpiAp2 TSS_4617 TSS_4617 tpiAp1 tpiAp1 TSS_4616 TSS_4616 TSS_4615 TSS_4615 TSS_4614 TSS_4614 TSS_4613 TSS_4613 TSS_4612 TSS_4612

Gene      
Name: tpiA    Texpresso search in the literature
Synonym(s): ECK3911, EG11015, b3919, tpi
Genome position(nucleotides): 4110740 <-- 4111507 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.6
External database links:  
ASAP:
ABE-0012799
CGSC:
88
ECHOBASE:
EB1008
ECOLIHUB:
tpiA
MIM:
615512
OU-MICROARRAY:
b3919
STRING:
511145.b3919
COLOMBOS: tpiA


Product      
Name: triose-phosphate isomerase
Synonym(s): Tpi, TpiA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.972
Isoelectric point: 5.855
Motif(s):
 
Type Positions Sequence
9 -> 11 NWK
67 -> 67 D
5 -> 246 LVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIV
233 -> 234 GG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.1 - glycolysis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0004807 - triose-phosphate isomerase activity
GO:0042802 - identical protein binding
biological_process GO:0006094 - gluconeogenesis
GO:0006096 - glycolytic process
GO:0019563 - glycerol catabolic process
GO:0046166 - glyceraldehyde-3-phosphate biosynthetic process
External database links:  
DIP:
DIP-31849N
ECOCYC:
TPI-MONOMER
ECOLIWIKI:
b3919
INTERPRO:
IPR022896
INTERPRO:
IPR035990
INTERPRO:
IPR000652
INTERPRO:
IPR013785
INTERPRO:
IPR020861
MODBASE:
P0A858
PANTHER:
PTHR21139
PDB:
1TRE
PDB:
1TMH
PFAM:
PF00121
PRIDE:
P0A858
PROSITE:
PS00171
PROSITE:
PS51440
REFSEQ:
NP_418354
SMR:
P0A858
UNIPROT:
P0A858


Operon      
Name: tpiA         
Operon arrangement:
Transcription unit        Promoter
tpiA
tpiA
tpiA


Transcriptional Regulation      
Display Regulation             
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4612 4111330 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4613 4111496 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4614 4111500 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4615 4111507 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4616 4111513 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4617 4111541 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4619 (cluster) 4111575 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB