RegulonDB RegulonDB 10.8: Gene Form
   

treA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

treA dhaM ycgY treAp treAp

Gene      
Name: treA    Texpresso search in the literature
Synonym(s): ECK1185, EG11017, b1197, osmA, tre
Genome position(nucleotides): 1245679 <-- 1247376 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.3
External database links:  
ASAP:
ABE-0004021
CGSC:
17572
ECHOBASE:
EB1010
OU-MICROARRAY:
b1197
PortEco:
treA
STRING:
511145.b1197
COLOMBOS: treA


Product      
Name: periplasmic trehalase
Synonym(s): OsmA, Tre, TreA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 63.637
Isoelectric point: 5.69
Motif(s):
 
Type Positions Sequence
159 -> 160 WD
205 -> 207 RSQ
1 -> 30 MKSPAPSRPQKMALIPACIFLCFAALSVQA
277 -> 279 RPE
31 -> 565 EETPVTPQPPDILLGPLFNDVQNAKLFPDQKTFADAVPNSDPLMILADYRMQQNQSGFDLRHFVNVNFTLPKEGEKYVPPEGQSLREHIDGLWPVLTRSTENTEKWDSLLPLPEPYVVPGGRFREVYYWDSYFTMLGLAESGHWDKVADMVANFAHEIDTYGHIPNGNRSYYLSRSQPPFFALMVELLAQHEGDAALKQYLPQMQKEYAYWMDGVENLQAGQQEKRVVKLQDGTLLNRYWDDRDTPRPESWVEDIATAKSNPNRPATEIYRDLRSAAASGWDFSSRWMDNPQQLNTLRTTSIVPVDLNSLMFKMEKILARASKAAGDNAMANQYETLANARQKGIEKYLWNDQQGWYADYDLKSHKVRNQLTAAALFPLYVNAAAKDRANKMATATKTHLLQPGGLNTTSVKSGQQWDAPNGWAPLQWVATEGLQNYGQKEVAMDISWHFLTNVQHTYDREKKLVEKYDVSTTGTGGGGGEYPLQDGFGWTNGVTLKMLDLICPKEQPCDNVPATRPTVKSATTQPSTKEAQPTP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.9 - misc. glucose metabolism
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004555 - alpha,alpha-trehalase activity
biological_process GO:0008152 - metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0005991 - trehalose metabolic process
GO:0005993 - trehalose catabolic process
GO:0071474 - cellular hyperosmotic response
Note(s): Note(s): ...[more].
Reference(s): [1] Li H., et al., 2012
External database links:  
CAZY:
GH37
DIP:
DIP-11022N
ECOCYC:
TREHALAPERI-MONOMER
ECOLIWIKI:
b1197
INTERPRO:
IPR023720
INTERPRO:
IPR018232
INTERPRO:
IPR012341
INTERPRO:
IPR008928
INTERPRO:
IPR001661
PANTHER:
PTHR23403
PDB:
2WYN
PDB:
2JJB
PDB:
2JF4
PDB:
2JG0
PFAM:
PF01204
PRIDE:
P13482
PRINTS:
PR00744
PRODB:
PRO_000024106
PROSITE:
PS00927
PROSITE:
PS00928
REFSEQ:
NP_415715
SMR:
P13482
UNIPROT:
P13482


Operon      
Name: treA         
Operon arrangement:
Transcription unit        Promoter
treA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Li H., Su H., Kim SB., Chang YK., Hong SK., Seo YG., Kim CJ., 2012, Enhanced production of trehalose in Escherichia coli by homologous expression of otsBA in the presence of the trehalase inhibitor, validamycin A, at high osmolarity., J Biosci Bioeng 113(2):224-32


RegulonDB