RegulonDB RegulonDB 10.7: Gene Form
   

trg gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

trg ydcI sokB mokB CRP Fis Fis trgp1 trgp1 mokBp3 mokBp3 sokBp sokBp

Gene      
Name: trg    Texpresso search in the literature
Synonym(s): ECK1415, EG11018, b1421
Genome position(nucleotides): 1492470 --> 1494110 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.25
External database links:  
ASAP:
ABE-0004744
CGSC:
85
ECHOBASE:
EB1011
OU-MICROARRAY:
b1421
PORTECO:
trg
REGULONDB:
b1421
STRING:
511145.b1421
M3D: trg
COLOMBOS: trg
PortEco: b1421


Product      
Name: methyl-accepting chemotaxis protein Trg
Synonym(s): MCP-III, Trg, Trg dimer, chemotaxis signaling protein III, ribose/galactose/glucose chemoreceptor protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 58.899
Isoelectric point: 6.532
Motif(s):
 
Type Positions Sequence
224 -> 276 RIVIRPLQHAAQRIEKIASGDLTMNDEPAGRNEIGRLSRHLQQMQHSLGMTVG
11 -> 177 FLHHIRLVPLFACILGGILVLFALSSALAGYFLWQADRDQRDVTAEIEIRTGLANSSDFLRSARINMIQAGAASRIAEMEAMKRNIAQAESEIKQSQQGYRAYQNRPVKTPADEALDTELNQRFQAYITGMQPMLKYAKNGMFEAIINHESEQIRPLDNAYTDILNK
24 -> 44 ILGGILVLFALSSALAGYFLW
335 -> 492 SKLAQEASIKASDGGQTVSGVVKTMGAISTSSKKISEITAVINSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRTLASRSAQAAKEIEGLISESVRLIDLGSDEVATAGKTMSTIVDAVASVTHIMQEIAAASDEQSRGITQVSQAISEMDKVT
202 -> 222 MFMIGAFVLALVMTLITFMVL

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0098561 - methyl accepting chemotaxis protein complex
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0004888 - transmembrane signaling receptor activity
GO:0042803 - protein homodimerization activity
biological_process GO:0007165 - signal transduction
GO:0006935 - chemotaxis
External database links:  
DIP:
DIP-11027N
ECOCYC:
TRG-MONOMER
ECOLIWIKI:
b1421
INTERPRO:
IPR004090
INTERPRO:
IPR035440
INTERPRO:
IPR004091
INTERPRO:
IPR003122
INTERPRO:
IPR003660
INTERPRO:
IPR004089
MINT:
MINT-1228342
MODBASE:
P05704
PFAM:
PF02203
PFAM:
PF00672
PFAM:
PF00015
PRIDE:
P05704
PRINTS:
PR00260
PRODB:
PRO_000024111
PROSITE:
PS50885
PROSITE:
PS50111
PROSITE:
PS00538
PROTEINMODELPORTAL:
P05704
REFSEQ:
NP_415938
SMART:
SM00283
SMART:
SM00319
SMART:
SM00304
SMR:
P05704
SWISSMODEL:
P05704
UNIPROT:
P05704


Operon      
Name: trg         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mokBp3 1492305 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB