RegulonDB RegulonDB 10.7: Gene Form
   

trpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

trpC trpB trpA yciG H-NS McbR H-NS McbR TSS_1694 TSS_1694 TSS_1693 TSS_1693 TSS_1692 TSS_1692 TSS_1691 TSS_1691 TSS_1690 (cluster) TSS_1690 (cluster) TSS_1689 TSS_1689 TSS_1688 TSS_1688 TSS_1687 TSS_1687 trpAp7 trpAp7 trpAp5 trpAp5 trpAp4 trpAp4 trpAp8 trpAp8 yciGp yciGp

Gene      
Name: trpA    Texpresso search in the literature
Synonym(s): ECK1254, EG11024, b1260, try, tryp
Genome position(nucleotides): 1316416 <-- 1317222 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.53
External database links:  
ASAP:
ABE-0004232
CGSC:
74
ECHOBASE:
EB1017
OU-MICROARRAY:
b1260
PORTECO:
trpA
REGULONDB:
b1260
STRING:
511145.b1260
M3D: trpA
COLOMBOS: trpA
PortEco: b1260


Product      
Name: tryptophan synthase subunit α
Synonym(s): alpha; subunit, A protein, TSase alpha;, TrpA, Try
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.724
Isoelectric point: 5.143
Motif(s):
 
Type Positions Sequence
8 -> 266 FAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAAT
209 -> 224 LQGFGISAPDQVKAAI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.15 - tryptophan
Gene Ontology Terms (GO)  
cellular_component GO:0009507 - chloroplast
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0004834 - tryptophan synthase activity
biological_process GO:0000162 - tryptophan biosynthetic process
GO:0006568 - tryptophan metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009073 - aromatic amino acid family biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35957N
DISPROT:
DP00252
ECOCYC:
TRYPSYN-APROTEIN
ECOLIWIKI:
b1260
INTERPRO:
IPR011060
INTERPRO:
IPR018204
INTERPRO:
IPR002028
INTERPRO:
IPR013785
MODBASE:
P0A877
PDB:
1XCF
PDB:
1XC4
PDB:
1WQ5
PDB:
1V7Y
PFAM:
PF00290
PRIDE:
P0A877
PRODB:
PRO_000024117
PROSITE:
PS00167
PROTEINMODELPORTAL:
P0A877
REFSEQ:
NP_415776
SMR:
P0A877
UNIPROT:
P0A877


Operon      
Name: trpLEDCBA         
Operon arrangement:
Transcription unit        Promoter
trpCBA
trpL
trpLEDCBA


Transcriptional Regulation      
Display Regulation             
Repressed by: TrpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter trpAp8 1317241 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter trpAp4 1317303 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter trpAp5 1317306 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter trpAp7 1317339 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1687 1317876 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1688 1317878 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1689 1318430 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1690 (cluster) 1318512 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1691 1318516 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1692 1318535 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1693 1318537 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1694 1318607 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB