RegulonDB RegulonDB 10.7: Gene Form
   

tsx gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tsx yajI yajD DeoR CRP CytR CytR CRP CytR tsxp1 tsxp1 TSS_525 TSS_525 tsxp2 tsxp2 TSS_524 TSS_524

Gene      
Name: tsx    Texpresso search in the literature
Synonym(s): ECK0405, EG11035, T6rec, b0411, nupA
Genome position(nucleotides): 431129 <-- 432013 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.51
External database links:  
ASAP:
ABE-0001425
CGSC:
62
ECHOBASE:
EB1028
OU-MICROARRAY:
b0411
PORTECO:
tsx
REGULONDB:
b0411
STRING:
511145.b0411
M3D: tsx
COLOMBOS: tsx
PortEco: b0411


Shine dalgarno      
Sequence: ggattttcaaACAGTGgcatacaTAT


Product      
Name: nucleoside-specific channel-forming protein Tsx
Synonym(s): NupA, Tsx, nucleoside channel; receptor of phage T6 and colicin K
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 33.589
Isoelectric point: 4.927
Motif(s):
 
Type Positions Sequence
276 -> 276 N
1 -> 22 MKKTLLAAGAVLALSSSFTVNA
23 -> 294 AENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF
32 -> 294 SDWWHQSVNVVGSYHTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.4 - colicin related
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0046930 - pore complex
molecular_function GO:0015288 - porin activity
GO:0005337 - nucleoside transmembrane transporter activity
GO:0015471 - nucleoside-specific channel forming porin activity
biological_process GO:0006811 - ion transport
GO:0015858 - nucleoside transport
GO:0046718 - viral entry into host cell
GO:0055085 - transmembrane transport
GO:1901642 - nucleoside transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jin M., et al., 2018
[2] Thoma J., et al., 2018
External database links:  
ECOCYC:
EG11035-MONOMER
ECOLIWIKI:
b0411
INTERPRO:
IPR003055
INTERPRO:
IPR018013
INTERPRO:
IPR036777
PDB:
1TLZ
PDB:
1TLY
PDB:
1TLW
PFAM:
PF03502
PRIDE:
P0A927
PRINTS:
PR01277
PRODB:
PRO_000024135
PROTEINMODELPORTAL:
P0A927
REFSEQ:
NP_414945
SMR:
P0A927
UNIPROT:
P0A927


Operon      
Name: tsx         
Operon arrangement:
Transcription unit        Promoter
tsx
tsx


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, DeoR, CytR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_524 432002 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_525 432185 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jin M., Lu J., Chen Z., Nguyen SH., Mao L., Li J., Yuan Z., Guo J., 2018, Antidepressant fluoxetine induces multiple antibiotics resistance in Escherichia coli via ROS-mediated mutagenesis., Environ Int 120:421-430

 [2] Thoma J., Manioglu S., Kalbermatter D., Bosshart PD., Fotiadis D., Muller DJ., 2018, Protein-enriched outer membrane vesicles as a native platform for outer membrane protein studies., Commun Biol 1:23

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB