RegulonDB RegulonDB 10.9: Gene Form
   

tufA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

chiA fusA tufA anti-anti-terminator terminator TSS_3906 TSS_3906 TSS_3905 TSS_3905 TSS_3904 TSS_3904 TSS_3903 TSS_3903 TSS_3902 TSS_3902 TSS_3901 TSS_3901 TSS_3900 TSS_3900 TSS_3899 TSS_3899 TSS_3898 (cluster) TSS_3898 (cluster) TSS_3897 TSS_3897 TSS_3896 TSS_3896 TSS_3895 TSS_3895 TSS_3894 (cluster) TSS_3894 (cluster) TSS_3893 TSS_3893 TSS_3892 (cluster) TSS_3892 (cluster) TSS_3891 TSS_3891 TSS_3890 TSS_3890 TSS_3889 (cluster) TSS_3889 (cluster) TSS_3888 TSS_3888 TSS_3887 TSS_3887 TSS_3886 (cluster) TSS_3886 (cluster) TSS_3885 TSS_3885 TSS_3884 TSS_3884 tufAp1 tufAp1 tufAp2 tufAp2 TSS_3882 TSS_3882 TSS_3881 TSS_3881 TSS_3880 TSS_3880 TSS_3879 TSS_3879 TSS_3878 TSS_3878 TSS_3877 TSS_3877 TSS_3876 TSS_3876 TSS_3875 (cluster) TSS_3875 (cluster) TSS_3874 TSS_3874 TSS_3873 (cluster) TSS_3873 (cluster) TSS_3872 TSS_3872 TSS_3871 TSS_3871 TSS_3870 TSS_3870 TSS_3869 (cluster) TSS_3869 (cluster) TSS_3868 TSS_3868 TSS_3867 (cluster) TSS_3867 (cluster) TSS_3866 TSS_3866 TSS_3865 TSS_3865 TSS_3864 TSS_3864 TSS_3863 TSS_3863 TSS_3862 (cluster) TSS_3862 (cluster) TSS_3861 (cluster) TSS_3861 (cluster) TSS_3860 TSS_3860 TSS_3859 (cluster) TSS_3859 (cluster) TSS_3858 TSS_3858 TSS_3857 (cluster) TSS_3857 (cluster) TSS_3856 TSS_3856 TSS_3855 (cluster) TSS_3855 (cluster) TSS_3854 (cluster) TSS_3854 (cluster) TSS_3853 TSS_3853 TSS_3852 TSS_3852 TSS_3851 (cluster) TSS_3851 (cluster) TSS_3850 TSS_3850 TSS_3849 TSS_3849 TSS_3848 TSS_3848 TSS_3847 TSS_3847 TSS_3846 TSS_3846 TSS_3845 TSS_3845 TSS_3844 (cluster) TSS_3844 (cluster) TSS_3843 TSS_3843 TSS_3842 (cluster) TSS_3842 (cluster) TSS_3841 TSS_3841 TSS_3840 TSS_3840 TSS_3839 TSS_3839 TSS_3838 TSS_3838 TSS_3837 TSS_3837 chiAp chiAp

Gene      
Name: tufA    Texpresso search in the literature
Synonym(s): ECK3326, EG11036, b3339, kirT, pulT
Genome position(nucleotides): 3470145 <-- 3471329 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.25
External database links:  
ASAP:
ABE-0010912
CGSC:
61
ECHOBASE:
EB1029
ECOLIHUB:
tufA
OU-MICROARRAY:
b3339
STRING:
511145.b3339
COLOMBOS: tufA


Product      
Name: translation elongation factor Tu 1
Synonym(s): EF-Tu, KirT, PulT, TufA, elongation factor Tu
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 43.284
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
21 -> 21 V
10 -> 204 KPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPE
19 -> 26 GHVDHGKT
60 -> 64 GITIN
136 -> 139 NKCD

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0003746 - translation elongation factor activity
GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0005525 - GTP binding
biological_process GO:0006412 - translation
GO:0006414 - translational elongation
GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
Reference(s): [1] Wasinger VC., et al., 1998
[2] Weijland A., et al., 1992
External database links:  
DIP:
DIP-6159N
ECOCYC:
EG11036-MONOMER
ECOLIWIKI:
b3339
INTERPRO:
IPR009000
INTERPRO:
IPR005225
INTERPRO:
IPR004541
INTERPRO:
IPR004161
INTERPRO:
IPR004160
INTERPRO:
IPR000795
INTERPRO:
IPR041709
INTERPRO:
IPR009001
INTERPRO:
IPR027417
INTERPRO:
IPR033720
INTERPRO:
IPR031157
MODBASE:
P0A6N1
PDB:
4Q7J
PDB:
4V69
PDB:
5I4Q
PDB:
5I4R
PDB:
5JBQ
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
4PC7
PDB:
4PC3
PDB:
4G5G
PDB:
3U6K
PDB:
3U6B
PDB:
3U2Q
PDB:
3EQ4
PDB:
3EQ3
PDB:
3EP2
PDB:
2HDN
PDB:
2HCJ
PDB:
2FX3
PDB:
1MJ1
PDB:
1ETU
PDB:
1EFC
PDB:
1D8T
PFAM:
PF00009
PFAM:
PF03144
PFAM:
PF03143
PRIDE:
P0CE47
PRINTS:
PR00315
PRODB:
PRO_000024141
PROSITE:
PS00301
PROSITE:
PS51722
REFSEQ:
NP_417798
SMR:
P0CE47
UNIPROT:
P0CE47


Operon      
Name: rpsLG-fusA-tufA         
Operon arrangement:
Transcription unit        Promoter
tufA
tufA
fusA-tufA
rpsLG-fusA-tufA


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3837 3470298 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3838 3470546 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3839 3470604 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3840 3470613 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3841 3470676 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3842 (cluster) 3470680 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3843 3470682 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3844 (cluster) 3470687 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3845 3470828 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3846 3470844 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3847 3471157 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3848 3471182 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3849 3471250 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3850 3471278 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3851 (cluster) 3471295 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3852 3471297 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3853 3471305 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3854 (cluster) 3471309 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3855 (cluster) 3471319 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3856 3471327 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3857 (cluster) 3471344 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3858 3471346 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3859 (cluster) 3471350 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3860 3471355 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3861 (cluster) 3471381 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3862 (cluster) 3471384 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3863 3471387 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3864 3471390 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3865 3471411 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3866 3471415 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3867 (cluster) 3471421 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3868 3471425 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3869 (cluster) 3471431 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3870 3471437 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3871 3471446 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3872 3471455 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3873 (cluster) 3471470 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3874 3471472 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3875 (cluster) 3471525 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3876 3471528 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3877 3471536 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3878 3471544 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3879 3471546 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3880 3471555 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3881 3471569 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3882 3471577 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3884 3471772 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3885 3471838 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3886 (cluster) 3471847 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3887 3471910 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3888 3472224 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3889 (cluster) 3472229 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3890 3472232 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3891 3472234 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3892 (cluster) 3472248 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3893 3472252 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3894 (cluster) 3472256 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3895 3472359 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3896 3472387 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3897 3472395 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3898 (cluster) 3472530 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3899 3472624 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3900 3472944 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3901 3473043 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3902 3473054 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3903 3473057 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3904 3473119 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3905 3473180 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3906 3473265 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Wasinger VC., Humphery-Smith I., 1998, Small genes/gene-products in Escherichia coli K-12., FEMS Microbiol Lett 169(2):375-82

 [2] Weijland A., Harmark K., Cool RH., Anborgh PH., Parmeggiani A., 1992, Elongation factor Tu: a molecular switch in protein biosynthesis., Mol Microbiol 6(6):683-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB