RegulonDB RegulonDB 9.3: Gene Form
   

tufB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tufB secE thrT terminator anti-terminator anti-anti-terminator TSS_4736 TSS_4736 TSS_4735 TSS_4735 TSS_4734 (cluster) TSS_4734 (cluster) TSS_4733 (cluster) TSS_4733 (cluster) TSS_4732 (cluster) TSS_4732 (cluster) TSS_4731 (cluster) TSS_4731 (cluster) TSS_4730 TSS_4730 TSS_4729 (cluster) TSS_4729 (cluster) TSS_4728 TSS_4728 secEp secEp TSS_4727 TSS_4727 TSS_4726 TSS_4726 TSS_4725 TSS_4725 TSS_4724 TSS_4724 TSS_4723 (cluster) TSS_4723 (cluster) TSS_4722 (cluster) TSS_4722 (cluster) TSS_4721 TSS_4721 TSS_4720 (cluster) TSS_4720 (cluster) TSS_4719 TSS_4719 TSS_4718 (cluster) TSS_4718 (cluster) TSS_4717 TSS_4717 TSS_4716 TSS_4716 TSS_4715 TSS_4715 TSS_4714 TSS_4714 TSS_4713 TSS_4713 TSS_4712 TSS_4712 TSS_4711 TSS_4711 TSS_4710 TSS_4710 TSS_4709 (cluster) TSS_4709 (cluster) TSS_4708 TSS_4708 TSS_4707 TSS_4707 TSS_4706 TSS_4706 TSS_4705 TSS_4705 TSS_4704 TSS_4704 TSS_4703 TSS_4703 TSS_4702 (cluster) TSS_4702 (cluster)

Gene      
Name: tufB    Texpresso search in the literature
Synonym(s): ECK3971, b3980, kirT, pulT
Genome position(nucleotides): 4175944 --> 4177128 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.42
External database links:  
OU-MICROARRAY:
b3980
M3D: tufB
COLOMBOS: tufB
PortEco: b3980


Product      
Name: elongation factor Tu
Synonym(s): B3980, EF-Tu, KirT, PulT, TufB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 43.314
Isoelectric point: 5.14
Motif(s):
 
Type Positions Sequence
262 -> 262 F
289 -> 289 R
10 -> 204 KPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPE
19 -> 26 GHVDHGKT
60 -> 64 GITIN

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Weijland A., et al., 1992
External database links:  
ECOCYC:
EG11037-MONOMER
GENPROTEC:
b3980
PDB:
1LS2
PDB:
1OB2
PDB:
1QZD
PDB:
2BVN
PDB:
3AGP
PDB:
3AGQ
PDB:
3AVT
PDB:
3AVU
PDB:
3AVV
PDB:
3AVW
PDB:
3AVX
PDB:
3AVY
PDB:
3MMP
PDB:
3VNU
PDB:
3VNV
PDB:
4FWT
PDB:
4V69
PDB:
4V6K
PDB:
4V6L
PDB:
5AFI
PDB:
1EFU
PDB:
1EFM
PDB:
1DG1


Operon      
Name: thrU-tyrU-glyT-thrT-tufB         
Operon arrangement:
Transcription unit        Promoter
thrU-tyrU-glyT-thrT-tufB


Transcriptional Regulation      
Display Regulation             
Note: The TF binding sites with unknown position are not displayed in the graphic.
Activated by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4702 (cluster) 4175869 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4703 4175874 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4704 4175883 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4705 4175917 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4706 4175920 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4707 4175926 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4708 4175928 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4709 (cluster) 4175958 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4710 4175968 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4711 4176116 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4712 4176325 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4713 4176332 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4714 4176429 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4715 4176443 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4716 4176445 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4717 4176452 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4718 (cluster) 4176586 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4719 4176591 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4720 (cluster) 4176593 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4721 4176597 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4722 (cluster) 4176659 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4723 (cluster) 4176669 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4724 4176704 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4725 4176727 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4726 4176739 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4727 4176975 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4728 4177213 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4729 (cluster) 4177243 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4730 4177246 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4731 (cluster) 4177278 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4732 (cluster) 4177295 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4733 (cluster) 4177301 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4734 (cluster) 4177329 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4735 4177340 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4736 4177443 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Weijland A., Harmark K., Cool RH., Anborgh PH., Parmeggiani A., 1992, Elongation factor Tu: a molecular switch in protein biosynthesis., Mol Microbiol. 6(6):683-8

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB