RegulonDB RegulonDB 9.1: Gene Form
   

tufB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tufB secE thrT terminator anti-terminator anti-anti-terminator TSS_4736 TSS_4736 TSS_4735 TSS_4735 TSS_4734 (cluster) TSS_4734 (cluster) TSS_4733 (cluster) TSS_4733 (cluster) TSS_4732 (cluster) TSS_4732 (cluster) TSS_4731 (cluster) TSS_4731 (cluster) TSS_4730 TSS_4730 TSS_4729 (cluster) TSS_4729 (cluster) TSS_4728 TSS_4728 secEp secEp TSS_4727 TSS_4727 TSS_4726 TSS_4726 TSS_4725 TSS_4725 TSS_4724 TSS_4724 TSS_4723 (cluster) TSS_4723 (cluster) TSS_4722 (cluster) TSS_4722 (cluster) TSS_4721 TSS_4721 TSS_4720 (cluster) TSS_4720 (cluster) TSS_4719 TSS_4719 TSS_4718 (cluster) TSS_4718 (cluster) TSS_4717 TSS_4717 TSS_4716 TSS_4716 TSS_4715 TSS_4715 TSS_4714 TSS_4714 TSS_4713 TSS_4713 TSS_4712 TSS_4712 TSS_4711 TSS_4711 TSS_4710 TSS_4710 TSS_4709 (cluster) TSS_4709 (cluster) TSS_4708 TSS_4708 TSS_4707 TSS_4707 TSS_4706 TSS_4706 TSS_4705 TSS_4705 TSS_4704 TSS_4704 TSS_4703 TSS_4703 TSS_4702 (cluster) TSS_4702 (cluster)

Gene      
Name: tufB    Texpresso search in the literature
Synonym(s): b3980, kirT, pulT
Genome position(nucleotides): 4173967 --> 4175151 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.42
External database links:  
ECOCYC:
EG11037
GENBANK:
1790412
GENBANK_RefSeq:
16131810
OU-MICROARRAY:
b3980
M3D: tufB
COLOMBOS: tufB
PortEco: b3980


Product      
Name: elongation factor Tu
Synonym(s): EF-Tu, KirT, PulT, TufB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 43.314
Isoelectric point: 5.14
Motif(s):
 
Type Positions Sequence
262 -> 262 F
289 -> 289 R
10 -> 204 KPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPE
19 -> 26 GHVDHGKT
60 -> 64 GITIN

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0005622 - intracellular
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0003746 - translation elongation factor activity
GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0005525 - GTP binding
biological_process GO:0006412 - translation
GO:0006414 - translational elongation
GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
Reference(s): [1] Weijland A., et al., 1992
External database links:  
ECOCYC:
EG11037-MONOMER
GENPROTEC:
b3980
PDB:
1QZD
PDB:
2BVN
PDB:
3AGP
PDB:
3AGQ
PDB:
3AVT
PDB:
1EFM
PDB:
1DG1
PDB:
3AVU
PDB:
3AVV
PDB:
3AVW
PDB:
3AVX
PDB:
3AVY
PDB:
3MMP
PDB:
3VNU
PDB:
3VNV
PDB:
4FWT
PDB:
4V69
PDB:
4V6K
PDB:
4V6L
PDB:
5AFI
PDB:
1OB2
PDB:
1LS2
PDB:
1EFU


Operon      
Name: thrU-tyrU-glyT-thrT-tufB         
Operon arrangement:
Transcription unit        Promoter
thrU-tyrU-glyT-thrT-tufB


Transcriptional Regulation      
Display Regulation             
Note: The TF binding sites with unknown position are not displayed in the graphic.
Activated by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4702 (cluster) 4173892 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4703 4173897 forward nd nd nd
  promoter TSS_4704 4173906 forward nd nd nd
  promoter TSS_4705 4173940 forward nd nd nd
  promoter TSS_4706 4173943 forward nd nd nd
  promoter TSS_4707 4173949 forward nd nd nd
  promoter TSS_4708 4173951 forward nd nd nd
  promoter TSS_4709 (cluster) 4173981 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4710 4173991 forward nd nd nd
  promoter TSS_4711 4174139 forward nd nd nd
  promoter TSS_4712 4174348 forward nd nd nd
  promoter TSS_4713 4174355 forward nd nd nd
  promoter TSS_4714 4174452 forward nd nd nd
  promoter TSS_4715 4174466 forward nd nd nd
  promoter TSS_4716 4174468 forward nd nd nd
  promoter TSS_4717 4174475 forward nd nd nd
  promoter TSS_4718 (cluster) 4174609 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4719 4174614 forward nd nd nd
  promoter TSS_4720 (cluster) 4174616 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4721 4174620 forward nd nd nd
  promoter TSS_4722 (cluster) 4174682 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4723 (cluster) 4174692 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4724 4174727 forward nd nd nd
  promoter TSS_4725 4174750 forward nd nd nd
  promoter TSS_4726 4174762 forward nd nd nd
  promoter TSS_4727 4174998 forward nd nd nd
  promoter TSS_4728 4175236 forward nd nd nd
  promoter TSS_4729 (cluster) 4175266 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4730 4175269 forward nd nd nd
  promoter TSS_4731 (cluster) 4175301 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4732 (cluster) 4175318 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4733 (cluster) 4175324 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4734 (cluster) 4175352 forward For this promoter, there
Read more >
nd nd
  promoter TSS_4735 4175363 forward nd nd nd
  promoter TSS_4736 4175466 reverse nd nd nd


Reference(s)    

 [1] Weijland A., Harmark K., Cool RH., Anborgh PH., Parmeggiani A., 1992, Elongation factor Tu: a molecular switch in protein biosynthesis., Mol Microbiol. 6(6):683-8


RegulonDB