RegulonDB RegulonDB 10.8: Gene Form
   

tus gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fumA fumC rstB tus CRP CRP CRP MarA SoxS Rob terminator fumCp fumCp fumCp1 fumCp1 tusp2 tusp2

Gene      
Name: tus    Texpresso search in the literature
Synonym(s): ECK1605, EG11038, b1610, tau
Genome position(nucleotides): 1684259 --> 1685188 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.75
External database links:  
ASAP:
ABE-0005378
CGSC:
17800
ECHOBASE:
EB1031
OU-MICROARRAY:
b1610
PortEco:
tus
STRING:
511145.b1610
COLOMBOS: tus


Product      
Name: DNA replication terminus site-binding protein
Synonym(s): DNA-binding protein; inhibition of replication at Ter sites, TBP, Tau, Tus, ter-binding protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.783
Isoelectric point: 10.087
Motif(s):
 
Type Positions Sequence
150 -> 150 L
85 -> 102 NRSSKAAVRLPGVLCYQV
134 -> 134 L
9 -> 306 RLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLY
121 -> 122 KT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006260 - DNA replication
GO:0006274 - DNA replication termination
GO:0071807 - replication fork arrest involved in DNA replication termination
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Skokotas A., et al., 1994
External database links:  
DIP:
DIP-11056N
ECOCYC:
EG11038-MONOMER
ECOLIWIKI:
b1610
INTERPRO:
IPR036384
INTERPRO:
IPR036381
INTERPRO:
IPR008865
MINT:
P16525
MODBASE:
P16525
PDB:
2I06
PDB:
4XR0
PDB:
4XR1
PDB:
4XR3
PDB:
2I05
PDB:
2EWJ
PDB:
4XR2
PDB:
1SUT
PDB:
1ECR
PFAM:
PF05472
PRIDE:
P16525
PRODB:
PRO_000024142
REFSEQ:
NP_416127
SMR:
P16525
UNIPROT:
P16525


Operon      
Name: tus         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tusp2 1684173 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Skokotas A., Wrobleski M., Hill TM., 1994, Isolation and characterization of mutants of Tus, the replication arrest protein of Escherichia coli., J Biol Chem 269(32):20446-55

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB