RegulonDB RegulonDB 10.8: Gene Form
   

tyrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pheA tyrA aroF TSS_2942 TSS_2942 TSS_2941 TSS_2941 TSS_2940 TSS_2940

Gene      
Name: tyrA    Texpresso search in the literature
Synonym(s): ECK2597, EG11039, b2600
Genome position(nucleotides): 2738948 <-- 2740069 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.32
External database links:  
ASAP:
ABE-0008547
CGSC:
58
ECHOBASE:
EB1032
OU-MICROARRAY:
b2600
PortEco:
tyrA
STRING:
511145.b2600
COLOMBOS: tyrA


Product      
Name: fused chorismate mutase/prephenate dehydrogenase
Synonym(s): TyrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.042
Isoelectric point: 5.868
Motif(s):
 
Type Positions Sequence
99 -> 361 RPVVIVGGGGQMGRLFEKMLTLSGYQVRILEQHDWDRAADIVADAGMVIVSVPIHVTEQVIGKLPPLPKDCILVDLASVKNGPLQAMLVAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRKPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSERNLALIKRYYKRFGEAIELLEQGDKQAFIDSFRKVEHWFGDYAQRFQSES
137 -> 344 ADIVADAGMVIVSVPIHVTEQVIGKLPPLPKDCILVDLASVKNGPLQAMLVAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRKPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSERNLALIKRYYKRFGEAIELLEQGDKQAFIDSFR
1 -> 90 MVAELTALRDQIDEVDKALLNLLAKRLELVAEVGEVKSRFGLPIYVPEREASMLASRRAEAEALGVPPDLIEDVLRRVMRESYSSENDKG
9 -> 86 RDQIDEVDKALLNLLAKRLELVAEVGEVKSRFGLPIYVPEREASMLASRRAEAEALGVPPDLIEDVLRRVMRESYSSE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.13 - phenylalanine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.14 - tyrosine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016853 - isomerase activity
GO:0016491 - oxidoreductase activity
GO:0004106 - chorismate mutase activity
GO:0008977 - prephenate dehydrogenase (NAD+) activity
GO:0004665 - prephenate dehydrogenase (NADP+) activity
GO:0042803 - protein homodimerization activity
GO:0070403 - NAD+ binding
biological_process GO:0008152 - metabolic process
GO:0006571 - tyrosine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009073 - aromatic amino acid family biosynthetic process
GO:0009094 - L-phenylalanine biosynthetic process
GO:0046417 - chorismate metabolic process
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-11059N
ECOCYC:
CHORISMUTPREPHENDEHYDROG-MONOMER
ECOLIWIKI:
b2600
INTERPRO:
IPR003099
INTERPRO:
IPR036979
INTERPRO:
IPR036291
INTERPRO:
IPR036263
INTERPRO:
IPR002701
INTERPRO:
IPR008244
INTERPRO:
IPR008927
INTERPRO:
IPR011277
MINT:
MINT-1255670
MODBASE:
P07023
PFAM:
PF01817
PFAM:
PF02153
PRIDE:
P07023
PRODB:
PRO_000024150
PROSITE:
PS51168
PROSITE:
PS51176
REFSEQ:
NP_417091
SMART:
SM00830
SMR:
P07023
UNIPROT:
P07023


Operon      
Name: aroF-tyrA         
Operon arrangement:
Transcription unit        Promoter
aroF-tyrA


Transcriptional Regulation      
Display Regulation             
Activated by: SoxR
Repressed by: TyrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2940 2737804 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2941 2739800 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2942 2740969 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB