RegulonDB RegulonDB 10.6.3: Gene Form
   

tyrR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tyrR ycjF tpx ycjX TyrR TyrR TSS_1749 TSS_1749 TSS_1748 (cluster) TSS_1748 (cluster) TSS_1747 TSS_1747 tyrRp tyrRp TSS_1746 TSS_1746

Gene      
Name: tyrR    Texpresso search in the literature
Synonym(s): ECK1319, EG11042, b1323
Genome position(nucleotides): 1386720 --> 1388261 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.14
External database links:  
ASAP:
ABE-0004440
CGSC:
55
ECHOBASE:
EB1035
ECOCYC:
EG11042
ECOLIHUB:
tyrR
OU-MICROARRAY:
b1323
REGULONDB:
b1323
STRING:
511145.b1323
M3D: tyrR
COLOMBOS: tyrR
PortEco: b1323


Product      
Name: DNA-binding transcriptional dual regulator TyrR
Synonym(s): TyrR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: EBP
Cellular location: cytosol
Molecular weight: 57.656
Isoelectric point: 5.537
Motif(s):
 
Type Positions Sequence
78 -> 149 EHLALSALLEALPEPVLSVDMKSKVDMANPASCQLFGQKLDRLRNHTAAQLINGFNFLRWLESEPQDSHNEH
483 -> 502 TRKLAKRLGVSHTAIANKLR
2 -> 72 RLEVFCEDRLGLTRELLDLLVLRGIDLRGIEIDPIGRIYLNFAELEFESFSSLMAEIRRIAGVTDVRTVPW
82 -> 134 LSALLEALPEPVLSVDMKSKVDMANPASCQLFGQKLDRLRNHTAAQLINGFNF
458 -> 507 EGSLDEITSRFERSVLTQLYRNYPSTRKLAKRLGVSHTAIANKLREYGLS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0008134 - transcription factor binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0019439 - aromatic compound catabolic process
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IMP] Inferred from mutant phenotype
Reference(s): [1] Argaet VP., et al., 1994
[2] Cornish EC., et al., 1986
[3] Cui J., et al., 1993
[4] Pittard AJ., et al., 1991
[5] Wallace BJ., et al., 1969
[6] Yang J., et al., 1993
[7] Yang J., et al., 2004
External database links:  
DIP:
DIP-11062N
ECOCYC:
PD00413
ECOLIWIKI:
b1323
INTERPRO:
IPR002912
INTERPRO:
IPR035965
INTERPRO:
IPR030828
INTERPRO:
IPR027417
INTERPRO:
IPR025944
INTERPRO:
IPR025943
INTERPRO:
IPR025662
INTERPRO:
IPR000014
INTERPRO:
IPR002078
INTERPRO:
IPR003593
INTERPRO:
IPR009057
MINT:
MINT-1240380
MODBASE:
P07604
PDB:
2JHE
PFAM:
PF00158
PFAM:
PF13188
PRIDE:
P07604
PRODB:
PRO_000024153
PROSITE:
PS50112
PROSITE:
PS00688
PROSITE:
PS50045
PROSITE:
PS51671
PROSITE:
PS00676
PROSITE:
PS00675
PROTEINMODELPORTAL:
P07604
REFSEQ:
NP_415839
SMART:
SM00091
SMART:
SM00382
SMR:
P07604
SWISSMODEL:
P07604
UNIPROT:
P07604


Operon      
Name: ycjXF-tyrR         
Operon arrangement:
Transcription unit        Promoter
ycjXF-tyrR
tyrR
null


Transcriptional Regulation      
Display Regulation             
Repressed by: TyrR, PgrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1746 1386691 forward nd [RS-EPT-CBR] [8]
  promoter TSS_1747 1387697 forward nd [RS-EPT-CBR] [8]
  promoter TSS_1748 (cluster) 1388610 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_1749 1388656 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Argaet VP., Wilson TJ., Davidson BE., 1994, Purification of the Escherichia coli regulatory protein TyrR and analysis of its interactions with ATP, tyrosine, phenylalanine, and tryptophan., J Biol Chem 269(7):5171-8

 [2] Cornish EC., Argyropoulos VP., Pittard J., Davidson BE., 1986, Structure of the Escherichia coli K12 regulatory gene tyrR. Nucleotide sequence and sites of initiation of transcription and translation., J Biol Chem 261(1):403-10

 [3] Cui J., Somerville RL., 1993, The TyrR protein of Escherichia coli, analysis by limited proteolysis of domain structure and ligand-mediated conformational changes., J Biol Chem 268(7):5040-7

 [4] Pittard AJ., Davidson BE., 1991, TyrR protein of Escherichia coli and its role as repressor and activator., Mol Microbiol 5(7):1585-92

 [5] Wallace BJ., Pittard J., 1969, Regulator gene controlling enzymes concerned in tyrosine biosynthesis in Escherichia coli., J Bacteriol 97(3):1234-41

 [6] Yang J., Ganesan S., Sarsero J., Pittard AJ., 1993, A genetic analysis of various functions of the TyrR protein of Escherichia coli., J Bacteriol 175(6):1767-76

 [7] Yang J., Hwang JS., Camakaris H., Irawaty W., Ishihama A., Pittard J., 2004, Mode of action of the TyrR protein: repression and activation of the tyrP promoter of Escherichia coli., Mol Microbiol 52(1):243-56

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB