RegulonDB RegulonDB 10.8: Gene Form
   

umuC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

umuC dsbB umuD C0299 LexA LexA Fis umuDp umuDp

Gene      
Name: umuC    Texpresso search in the literature
Synonym(s): ECK1172, EG11056, b1184, uvm
Genome position(nucleotides): 1231186 --> 1232454 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.99
External database links:  
ASAP:
ABE-0003977
CGSC:
34
ECHOBASE:
EB1049
OU-MICROARRAY:
b1184
PortEco:
umuC
STRING:
511145.b1184
COLOMBOS: umuC


Product      
Name: DNA polymerase V catalytic protein
Synonym(s): UmuC, Uvm
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 47.68
Isoelectric point: 9.092
Motif(s):
 
Type Positions Sequence
75 -> 75 E
6 -> 150 DVNAFYASCETVFRPDLWGKPVVVLSNNDGCVIARNAEAKALGVKMGDPWFKQKDLFRRCGVVCFSSNYELYADMSNRVMSTLEELSPRVEIYSIDEAFCDLTGVRNCRDLTDFGREIRATVLQRTHLTVGVGIAQTKTLAKLAN
172 -> 200 QRKLMSALPVDDVWGIGRRISKKLDAMGI
290 -> 290 T
2 -> 188 FALCDVNAFYASCETVFRPDLWGKPVVVLSNNDGCVIARNAEAKALGVKMGDPWFKQKDLFRRCGVVCFSSNYELYADMSNRVMSTLEELSPRVEIYSIDEAFCDLTGVRNCRDLTDFGREIRATVLQRTHLTVGVGIAQTKTLAKLANHAAKKWQRQTGGVVDLSNLERQRKLMSALPVDDVWGIG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0009355 - DNA polymerase V complex
molecular_function GO:0003697 - single-stranded DNA binding
GO:0003887 - DNA-directed DNA polymerase activity
GO:0005515 - protein binding
GO:0008094 - DNA-dependent ATPase activity
GO:0003684 - damaged DNA binding
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0019985 - translesion synthesis
Note(s): Note(s): ...[more].
Reference(s): [1] Elledge SJ., et al., 1983
[2] Krasovec R., et al., 2018
[3] Shinagawa H., et al., 1983
[4] Timinskas K., et al., 2019
External database links:  
DIP:
DIP-11090N
ECOCYC:
EG11056-MONOMER
ECOLIWIKI:
b1184
INTERPRO:
IPR017961
INTERPRO:
IPR036775
INTERPRO:
IPR025188
INTERPRO:
IPR024728
INTERPRO:
IPR001126
MINT:
MINT-1516814
MODBASE:
P04152
PFAM:
PF00817
PFAM:
PF13438
PFAM:
PF11799
PFAM:
PF11798
PRIDE:
P04152
PRODB:
PRO_000024182
PROSITE:
PS50173
REFSEQ:
NP_415702
SMR:
P04152
UNIPROT:
P04152


Operon      
Name: umuDC         
Operon arrangement:
Transcription unit        Promoter
umuDC


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Elledge SJ., Walker GC., 1983, Proteins required for ultraviolet light and chemical mutagenesis. Identification of the products of the umuC locus of Escherichia coli., J Mol Biol 164(2):175-92

 [2] Krasovec R., Richards H., Gifford DR., Belavkin RV., Channon A., Aston E., McBain AJ., Knight CG., 2018, Opposing effects of final population density and stress on Escherichia coli mutation rate., ISME J 12(12):2981-2987

 [3] Shinagawa H., Kato T., Ise T., Makino K., Nakata A., 1983, Cloning and characterization of the umu operon responsible for inducible mutagenesis in Escherichia coli., Gene 23(2):167-74

 [4] Timinskas K., Venclovas C., 2019, New insights into the structures and interactions of bacterial Y-family DNA polymerases., Nucleic Acids Res 47(9):4393-4405


RegulonDB