RegulonDB RegulonDB 10.8: Gene Form
   

umuD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

umuC hlyE dsbB umuD C0299 LexA LexA Fis Fis Fis FNR CRP SlyA H-NS SlyA H-NS Fis Fis SlyA SlyA SlyA SlyA umuDp umuDp hlyEp hlyEp

Gene      
Name: umuD    Texpresso search in the literature
Synonym(s): ECK1171, EG11057, b1183
Genome position(nucleotides): 1230767 --> 1231186 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.1
External database links:  
ASAP:
ABE-0003974
CGSC:
17788
ECHOBASE:
EB1050
OU-MICROARRAY:
b1183
PortEco:
umuD
STRING:
511145.b1183
COLOMBOS: umuD


Product      
Name: DNA polymerase V protein UmuD
Synonym(s): UmuD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.063
Isoelectric point: 4.342
Motif(s):
 
Type Positions Sequence
65 -> 65 G
27 -> 27 P
92 -> 92 G
25 -> 139 GFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITISSEDTLDVFGVVIHVVKAMR
57 -> 120 SGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITIS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009355 - DNA polymerase V complex
molecular_function GO:0003677 - DNA binding
GO:0003697 - single-stranded DNA binding
GO:0003887 - DNA-directed DNA polymerase activity
GO:0005515 - protein binding
GO:0008094 - DNA-dependent ATPase activity
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0008236 - serine-type peptidase activity
GO:0042802 - identical protein binding
biological_process GO:0006281 - DNA repair
GO:0006355 - regulation of transcription, DNA-templated
GO:0006508 - proteolysis
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0019985 - translesion synthesis
Note(s): Note(s): ...[more].
Reference(s): [1] Elledge SJ., et al., 1983
[2] Shinagawa H., et al., 1983
External database links:  
DIP:
DIP-29679N
DISPROT:
DP00626
ECOCYC:
EG11057-MONOMER
ECOLIWIKI:
b1183
INTERPRO:
IPR036286
INTERPRO:
IPR015927
INTERPRO:
IPR039418
INTERPRO:
IPR006197
MODBASE:
P0AG11
PDB:
1UMU
PDB:
1I4V
PDB:
1AY9
PFAM:
PF00717
PRIDE:
P0AG11
PRINTS:
PR00726
PRODB:
PRO_000024183
REFSEQ:
NP_415701
SMR:
P0AG11
SWISSMODEL:
P0AG11
UNIPROT:
P0AG11


Operon      
Name: umuDC         
Operon arrangement:
Transcription unit        Promoter
umuDC


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Elledge SJ., Walker GC., 1983, Proteins required for ultraviolet light and chemical mutagenesis. Identification of the products of the umuC locus of Escherichia coli., J Mol Biol 164(2):175-92

 [2] Shinagawa H., Kato T., Ise T., Makino K., Nakata A., 1983, Cloning and characterization of the umu operon responsible for inducible mutagenesis in Escherichia coli., Gene 23(2):167-74


RegulonDB