RegulonDB RegulonDB 10.8: Gene Form
   

ung gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfiF ung grcA Fis CpxR Fis ArcA FNR ArcA FNR CRP Fis PdhR ungp ungp TSS_2888 TSS_2888 TSS_2887 TSS_2887 grcAp1 grcAp1 TSS_2886 (cluster) TSS_2886 (cluster) TSS_2885 (cluster) TSS_2885 (cluster) grcAp2 grcAp2 TSS_2884 (cluster) TSS_2884 (cluster) TSS_2883 TSS_2883 TSS_2882 TSS_2882 TSS_2881 TSS_2881 TSS_2880 TSS_2880 TSS_2879 (cluster) TSS_2879 (cluster) TSS_2878 (cluster) TSS_2878 (cluster) TSS_2877 TSS_2877 TSS_2876 TSS_2876 TSS_2875 TSS_2875

Gene      
Name: ung    Texpresso search in the literature
Synonym(s): ECK2578, EG11058, b2580
Genome position(nucleotides): 2716754 --> 2717443 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.17
External database links:  
ASAP:
ABE-0008495
CGSC:
25
ECHOBASE:
EB1051
MIM:
608106
OU-MICROARRAY:
b2580
PortEco:
ung
STRING:
511145.b2580
COLOMBOS: ung


Product      
Name: uracil-DNA glycosylase
Synonym(s): Ung
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.693
Isoelectric point: 7.22
Motif(s):
 
Type Positions Sequence
55 -> 209 DVKVVILGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQW
2 -> 229 ANELTWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDWMPVLPAESE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016799 - hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0004844 - uracil DNA N-glycosylase activity
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0006284 - base-excision repair
GO:0097510 - base-excision repair, AP site formation via deaminated base removal
Note(s): Note(s): ...[more].
Reference(s): [1] Cronan GE., et al., 2019
[2] Warner HR., et al., 1981
External database links:  
DIP:
DIP-11092N
ECOCYC:
EG11058-MONOMER
ECOLIWIKI:
b2580
INTERPRO:
IPR018085
INTERPRO:
IPR036895
INTERPRO:
IPR005122
INTERPRO:
IPR002043
MINT:
MINT-194643
MODBASE:
P12295
PANTHER:
PTHR11264
PDB:
1UUG
PDB:
2EUG
PDB:
2UUG
PDB:
3EUG
PDB:
3UF7
PDB:
4EUG
PDB:
5EUG
PDB:
1EUI
PDB:
1EUG
PDB:
1LQM
PDB:
1LQJ
PDB:
1FLZ
PDB:
1LQG
PFAM:
PF03167
PRIDE:
P12295
PROSITE:
PS00130
REFSEQ:
NP_417075
SMART:
SM00986
SMR:
P12295
UNIPROT:
P12295


Operon      
Name: ung         
Operon arrangement:
Transcription unit        Promoter
ung


Transcriptional Regulation      
Display Regulation             
Repressed by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2875 2716280 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2876 2716282 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2877 2716291 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2878 (cluster) 2716431 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2879 (cluster) 2716446 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2880 2716470 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2881 2716473 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2882 2716478 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2883 2716482 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2884 (cluster) 2716501 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2885 (cluster) 2716511 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2886 (cluster) 2716522 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2887 2716686 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2888 2716730 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Cronan GE., Kouzminova EA., Kuzminov A., 2019, Near-continuously synthesized leading strands in Escherichia coli are broken by ribonucleotide excision., Proc Natl Acad Sci U S A 116(4):1251-1260

 [2] Warner HR., Duncan BK., Garrett C., Neuhard J., 1981, Synthesis and metabolism of uracil-containing deoxyribonucleic acid in Escherichia coli., J Bacteriol 145(2):687-95

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB