RegulonDB RegulonDB 10.8: Gene Form
   

uvrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uvrA ssb yjbR ArcA ArcA ArcA LexA ArcA ssbp1 ssbp1 ssbp2 ssbp2 ssbp3 ssbp3 uvrAp uvrAp TSS_4897 (cluster) TSS_4897 (cluster) TSS_4896 TSS_4896 TSS_4895 TSS_4895

Gene      
Name: uvrA    Texpresso search in the literature
Synonym(s): ECK4050, EG11061, b4058, dar, dinE
Genome position(nucleotides): 4271049 <-- 4273871 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.08
External database links:  
ASAP:
ABE-0013290
CGSC:
21
ECHOBASE:
EB1054
OU-MICROARRAY:
b4058
PortEco:
uvrA
STRING:
511145.b4058
COLOMBOS: uvrA


Product      
Name: excision nuclease subunit A
Synonym(s): Dar, DinE, UvrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 103.867
Isoelectric point: 6.62
Motif(s):
 
Type Positions Sequence
31 -> 38 GLSGSGKS
290 -> 399 DPDRVIQNPELSLAGGAIRGWDRRNFYYFQMLKSLADHYKFDVEAPWGSLSANVHKVVLYGSGKENIEFKYMNDRGDTSIRRHPFEGVLHNMERRYKETESSAVREELAK
806 -> 860 LARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYILDEPT
130 -> 237 QTVSQMVDNVLSQPEGKRLMLLAPIIKERKGEHTKTLENLASQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVVDRFKVRDDLTQRLAESFETALELSGGTAVVADM
607 -> 937 ANPEKVLKLTGARGNNLKDVTLTLPVGLFTCITGVSGSGKSTLINDTLFPIAQRQLNGATIAEPAPYRDIQGLEHFDKVIDIDQSPIGRTPRSNPATYTGVFTPVRELFAGVPESRARGYTPGRFSFNVRGGRCEACQGDGVIKVEMHFLPDIYVPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEAREFFDAVPALARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYILDEPTTGLHFADIQQLLDVLHKLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVAECEASHTARFLK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  5 - cell processes --> 5.6 - protection --> 5.6.1 - radiation
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009380 - excinuclease repair complex
molecular_function GO:0003677 - DNA binding
GO:0004518 - nuclease activity
GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008270 - zinc ion binding
GO:0009381 - excinuclease ABC activity
GO:0042802 - identical protein binding
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0009314 - response to radiation
GO:0006289 - nucleotide-excision repair
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Cronan GE., et al., 2019
External database links:  
DIP:
DIP-35876N
ECOCYC:
EG11061-MONOMER
ECOLIWIKI:
b4058
INTERPRO:
IPR017871
INTERPRO:
IPR041552
INTERPRO:
IPR041102
INTERPRO:
IPR027417
INTERPRO:
IPR004602
INTERPRO:
IPR003439
MINT:
MINT-1257037
MODBASE:
P0A698
PDB:
4DFC
PFAM:
PF17760
PFAM:
PF00005
PFAM:
PF17755
PRIDE:
P0A698
PRODB:
PRO_000024198
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_418482
SMR:
P0A698
UNIPROT:
P0A698


Operon      
Name: uvrA         
Operon arrangement:
Transcription unit        Promoter
uvrA


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4895 4270712 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4896 4273337 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4897 (cluster) 4273934 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Cronan GE., Kouzminova EA., Kuzminov A., 2019, Near-continuously synthesized leading strands in Escherichia coli are broken by ribonucleotide excision., Proc Natl Acad Sci U S A 116(4):1251-1260

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB