RegulonDB RegulonDB 10.7: Gene Form
   

uvrC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uvrC pgsA uvrY yecC3\' uvrCp3 uvrCp3 TSS_2248 TSS_2248 TSS_2247 TSS_2247

Gene      
Name: uvrC    Texpresso search in the literature
Synonym(s): ECK1912, EG11063, b1913
Genome position(nucleotides): 1992874 <-- 1994706 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.72
External database links:  
ASAP:
ABE-0006370
CGSC:
19
ECHOBASE:
EB1056
OU-MICROARRAY:
b1913
PORTECO:
uvrC
REGULONDB:
b1913
STRING:
511145.b1913
M3D: uvrC
COLOMBOS: uvrC
PortEco: b1913


Product      
Name: excision nuclease subunit C
Synonym(s): UvrC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 68.188
Isoelectric point: 9.385
Motif(s):
 
Type Positions Sequence
399 -> 399 D
438 -> 438 D
466 -> 466 D
16 -> 94 SQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQIDVTVTHTETEALLLEHNYIKLYQPRYNV
42 -> 42 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.2 - DNA
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  2 - information transfer --> 2.1 - DNA related --> 2.1.5 - DNA degradation
  5 - cell processes --> 5.6 - protection --> 5.6.1 - radiation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009380 - excinuclease repair complex
molecular_function GO:0003677 - DNA binding
GO:0004518 - nuclease activity
GO:0009381 - excinuclease ABC activity
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0009314 - response to radiation
GO:0006289 - nucleotide-excision repair
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47875N
ECOCYC:
EG11063-MONOMER
ECOLIWIKI:
b1913
INTERPRO:
IPR000305
INTERPRO:
IPR035901
INTERPRO:
IPR038476
INTERPRO:
IPR036876
INTERPRO:
IPR001162
INTERPRO:
IPR001943
INTERPRO:
IPR003583
INTERPRO:
IPR004791
INTERPRO:
IPR010994
MINT:
MINT-1221235
MODBASE:
P0A8G0
PDB:
1KFT
PFAM:
PF08459
PFAM:
PF02151
PFAM:
PF01541
PRIDE:
P0A8G0
PRODB:
PRO_000024200
PROSITE:
PS50165
PROSITE:
PS50164
PROSITE:
PS50151
PROTEINMODELPORTAL:
P0A8G0
REFSEQ:
NP_416423
SMART:
SM00278
SMART:
SM00465
SMR:
P0A8G0
SWISSMODEL:
P0A8G0
UNIPROT:
P0A8G0


Operon      
Name: uvrYC         
Operon arrangement:
Transcription unit        Promoter
uvrC
uvrYC


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2247 1992850 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2248 1994876 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB