RegulonDB RegulonDB 10.8: Gene Form
   

uvrD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uvrD yigE yigB yigE5\' LexA terminator TSS_4475 TSS_4475 TSS_4474 TSS_4474 uvrDp2 uvrDp2 uvrDp1 uvrDp1 TSS_4472 TSS_4472

Gene      
Name: uvrD    Texpresso search in the literature
Synonym(s): ECK3808, EG11064, b3813, dar-2, dda, mutU, pdeB, rad, recL, srjC, uvr502, uvrE
Genome position(nucleotides): 3997983 --> 4000145 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.7
External database links:  
ASAP:
ABE-0012455
CGSC:
18
ECHOBASE:
EB1057
OU-MICROARRAY:
b3813
PortEco:
uvrD
STRING:
511145.b3813
COLOMBOS: uvrD


Product      
Name: DNA helicase II
Synonym(s): Dda, MutU, PdeB, Rad, RecL, SrjC, UvrD, UvrE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 81.99
Isoelectric point: 6.16
Motif(s):
 
Type Positions Sequence
57 -> 74 IMAVTFTNKAAAEMRHRI
351 -> 357 AILYRSN
8 -> 286 DSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVENCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQGGMWVGTFHGLAHRLLRAHHMDANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQSYGNPVEQTWQKVYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDTGKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAETIRLEQNYRST
245 -> 259 IVGDDDQSIYGWRGA
618 -> 622 RRLYG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0033202 - DNA helicase complex
molecular_function GO:0003677 - DNA binding
GO:0003678 - DNA helicase activity
GO:0004386 - helicase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0043138 - 3'-5' DNA helicase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042803 - protein homodimerization activity
GO:0015616 - DNA translocase activity
GO:0017116 - single-stranded DNA helicase activity
biological_process GO:0006260 - DNA replication
GO:0006268 - DNA unwinding involved in DNA replication
GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0009314 - response to radiation
GO:0032508 - DNA duplex unwinding
GO:0006289 - nucleotide-excision repair
GO:0006298 - mismatch repair
GO:0000725 - recombinational repair
GO:0031297 - replication fork processing
GO:0070581 - rolling circle DNA replication
External database links:  
DIP:
DIP-11103N
DISPROT:
DP00684
ECOCYC:
EG11064-MONOMER
ECOLIWIKI:
b3813
INTERPRO:
IPR000212
INTERPRO:
IPR034739
INTERPRO:
IPR027417
INTERPRO:
IPR014017
INTERPRO:
IPR014016
INTERPRO:
IPR013986
INTERPRO:
IPR005753
MINT:
MINT-1223204
MODBASE:
P03018
PANTHER:
PTHR11070
PDB:
2IS6
PDB:
2IS1
PDB:
3LFU
PDB:
2IS2
PDB:
2IS4
PFAM:
PF13361
PFAM:
PF00580
PRIDE:
P03018
PRODB:
PRO_000024201
PROSITE:
PS51217
PROSITE:
PS51198
REFSEQ:
NP_418258
SMR:
P03018
SWISSMODEL:
P03018
UNIPROT:
P03018


Operon      
Name: uvrD         
Operon arrangement:
Transcription unit        Promoter
uvrD
uvrD


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4472 3997751 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4474 3998622 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4475 3998664 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB