RegulonDB RegulonDB 10.6.3: Gene Form
   

uxaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uxaB dgcF yneE ExuR CRP uxaBp2 uxaBp2 uxaBp uxaBp yneEp5 yneEp5 yneEp7 yneEp7

Gene      
Name: uxaB    Texpresso search in the literature
Synonym(s): ECK1514, EG11065, b1521
Genome position(nucleotides): 1609229 <-- 1610680 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.0
External database links:  
ASAP:
ABE-0005076
CGSC:
16
ECHOBASE:
EB1058
ECOCYC:
EG11065
ECOLIHUB:
uxaB
OU-MICROARRAY:
b1521
REGULONDB:
b1521
STRING:
511145.b1521
M3D: uxaB
COLOMBOS: uxaB
PortEco: b1521


Product      
Name: tagaturonate reductase
Synonym(s): UxaB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 54.808
Isoelectric point: 4.749
Motif(s):
 
Type Positions Sequence
18 -> 29 IIQFGEGNFLRA
17 -> 172 RIIQFGEGNFLRAFVDWQIDLLNEHTDLNSGVVVVRPIETSFPPSLSTQDGLYTTIIRGLNEKGEAVSDARLIRSVNREISVYSEYDEFLKLAHNPEMRFVFSNTTEAGISYHAGDKFDDAPAVSYPAKLTRLLFERFSHFNGALDKGWIIIPCEL
203 -> 458 QANSFCSTLVDRIVTGYPRDEVAKLEEELGYHDGFLDTAEHFYLFVIQGPKSLATELRLDKYPLNVLIVDDIKPYKERKVAILNGAHTALVPVAFQAGLDTVGEAMNDAEICAFVEKAIYEEIIPVLDLPRDELESFASAVTGRFRNPYIKHQLLSIALNGMTKFRTRILPQLLAGQKANGTLPARLTFALAALIAFYRGERNGETYPVQDDAHWLERYQQLWSQHRDRVIGTQELVAIVLAEKDHWEQDLTQVPG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0050662 - coenzyme binding
GO:0009026 - tagaturonate reductase activity
GO:0051287 - NAD binding
biological_process GO:0019698 - D-galacturonate catabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Bardonnet N., et al., 1988
[2] Blanco C., et al., 1986
[3] Blanco C., et al., 1983
[4] Hugouvieux-Cotte-Pattat N., et al., 1983
[5] Mata-Gilsinger M., et al., 1983
External database links:  
ECOCYC:
ALTRO-OXIDOREDUCT-MONOMER
ECOLIWIKI:
b1521
INTERPRO:
IPR013328
INTERPRO:
IPR036291
INTERPRO:
IPR023668
INTERPRO:
IPR013131
INTERPRO:
IPR013118
INTERPRO:
IPR008927
MODBASE:
P0A6L7
PFAM:
PF01232
PFAM:
PF08125
PRIDE:
P0A6L7
PRODB:
PRO_000024204
PROTEINMODELPORTAL:
P0A6L7
REFSEQ:
YP_025302
SMR:
P0A6L7
UNIPROT:
P0A6L7


Operon      
Name: uxaB         
Operon arrangement:
Transcription unit        Promoter
uxaB
uxaB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: ExuR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yneEp7 1609140 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter yneEp5 1609182 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter uxaBp2 1610737 reverse nd [AIPP] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Bardonnet N., Trautwetter A., Couchoux-Luthaud G., Blanco C., 1988, Plasmids with the uidA reporter gene for the detection of promoters and transcription signals., Mol Gen Genet 212(2):390-2

 [2] Blanco C., Mata-Gilsinger M., 1986, A DNA sequence containing the control sites for the uxaB gene of Escherichia coli., J Gen Microbiol 132(3):697-705

 [3] Blanco C., Mata-Gilsinger M., Ritzenthaler P., 1983, Construction of hybrid plasmids containing the Escherichia coli uxaB gene: analysis of its regulation and direction of transcription., J Bacteriol 153(2):747-55

 [4] Hugouvieux-Cotte-Pattat N., Robert-Baudouy J., 1983, Determination of the transcription direction of the uxaB gene, in Escherichia coli K12., Mol Gen Genet 189(2):334-6

 [5] Mata-Gilsinger M., Ritzenthaler P., Blanco C., 1983, Characterization of the operator sites of the exu regulon in Escherichia coli K-12 by operator-constitutive mutations and repressor titration., Genetics 105(4):829-42

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB