RegulonDB RegulonDB 11.0: Gene Form
   

xylE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xylE psiE malH malG CRP XylR XylR xylEp xylEp xylEp1 xylEp1 xylEp8 xylEp8

Gene      
Name: xylE    Texpresso search in the literature
Synonym(s): ECK4023, EG11076, b4031
Genome position(nucleotides): 4240779 <-- 4242254
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.59
Reference(s): [1] Maiden MC., et al., 1987
External database links:  
ASAP:
ABE-0013189
CGSC:
17776
ECHOBASE:
EB1069
ECOLIHUB:
xylE
MIM:
612126
MIM:
614847
MIM:
601042
MIM:
608885
MIM:
606777
OU-MICROARRAY:
b4031
STRING:
511145.b4031
COLOMBOS: xylE


Product      
Name: D-xylose:H+ symporter
Synonym(s): XylE, xylose MFS transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 53.608
Isoelectric point: 8.244
Motif(s):
 
Type Positions Sequence Comment
10 -> 32 IFSITLVATLGGLLFGYDTAVIS UniProt: Helical; Name=1.
14 -> 478 TLVATLGGLLFGYDTAVISGTVESLNTVFVAPQNLSESAANSLLGFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPVYLAGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQEQAEGILRKIMGNTLATQAVQEIKHSLDHGRKTGGRLLMFGVGVIVIGVMLSIFQQFVGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGALGMAIGMFSLGTAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELEALW
24 -> 24 F UniProt: Decreases xylose transport..
59 -> 79 FCVASALIGCIIGGALGGYCS UniProt: Helical; Name=2.
64 -> 64 A UniProt: In Ref. 6; CAA29863..

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015293 - symporter activity
GO:0022857 - transmembrane transporter activity
GO:0015519 - D-xylose:proton symporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0015753 - D-xylose transmembrane transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [2] Harris NJ., et al., 2020
External database links:  
ALPHAFOLD:
P0AGF4
ECOCYC:
XYLE-MONOMER
ECOLIWIKI:
b4031
INTERPRO:
IPR003663
INTERPRO:
IPR005828
INTERPRO:
IPR036259
INTERPRO:
IPR020846
INTERPRO:
IPR005829
MODBASE:
P0AGF4
PDB:
6N3I
PDB:
4QIQ
PDB:
4JA3
PDB:
4GC0
PDB:
4GBZ
PDB:
4GBY
PDB:
4JA4
PFAM:
PF00083
PRIDE:
P0AGF4
PRINTS:
PR00171
PRODB:
PRO_000024241
PROSITE:
PS00217
PROSITE:
PS00216
PROSITE:
PS50850
REFSEQ:
NP_418455
SMR:
P0AGF4
UNIPROT:
P0AGF4


Operon      
Name: xylE         
Operon arrangement:
Transcription unit        Promoter
xylE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, XylR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter xylEp8 4242260 reverse nd [ICWHO] [3]
  promoter xylEp1 4242270 reverse nd [ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Maiden MC., Davis EO., Baldwin SA., Moore DC., Henderson PJ., 1987, Mammalian and bacterial sugar transport proteins are homologous., Nature 325(6105):641-3

 [2] Harris NJ., Pellowe GA., Booth PJ., 2020, Cell-free expression tools to study co-translational folding of alpha helical membrane transporters., Sci Rep 10(1):9125

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB