RegulonDB RegulonDB 10.7: Gene Form
   

nhaR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nhaA nhaR insAB-1 insB-1 insA-1 TSS_44 (cluster) TSS_44 (cluster) TSS_43 TSS_43 TSS_42 TSS_42

Gene      
Name: nhaR    Texpresso search in the literature
Synonym(s): ECK0021, EG11078, antO, b0020, yaaB
Genome position(nucleotides): 18715 --> 19620 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.46
External database links:  
ASAP:
ABE-0000072
CGSC:
30281
ECHOBASE:
EB1070
OU-MICROARRAY:
b0020
PORTECO:
nhaR
REGULONDB:
b0020
STRING:
511145.b0020
M3D: nhaR
COLOMBOS: nhaR
PortEco: b0020


Product      
Name: DNA-binding transcriptional activator NhaR
Synonym(s): AntO, NhaR, YaaB
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 34.284
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
46 -> 47 ER
50 -> 50 G
58 -> 65 RGLEPSEL
134 -> 134 E
233 -> 301 FGAMHNAIFVAPTLYAYDFYADKTVVEIGRVENVMEEYHAIFAERMIQHPAVQRICNTDYSALFSPAVR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:2000144 - positive regulation of DNA-templated transcription, initiation
Note(s): Note(s): ...[more].
Reference(s): [1] Carmel O., et al., 1994
[2] Henikoff S., et al., 1988
[3] Mackie GA. 1986
[4] Rahav-Manor O., et al., 1992
[5] Yura T., et al., 1992
External database links:  
ECOCYC:
PD00474
ECOLIWIKI:
b0020
INTERPRO:
IPR005119
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR000847
MODBASE:
P0A9G2
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P0A9G2
PRODB:
PRO_000023381
PROSITE:
PS50931
PROTEINMODELPORTAL:
P0A9G2
REFSEQ:
NP_414561
SMR:
P0A9G2
UNIPROT:
P0A9G2


Operon      
Name: nhaAR         
Operon arrangement:
Transcription unit        Promoter
nhaAR
nhaAR
nhaR


Transcriptional Regulation      
Display Regulation             
Activated by: NhaR
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_42 18023 forward nd [RS-EPT-CBR] [6]
  promoter TSS_43 18025 forward nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Carmel O., Dover N., Rahav-Manor O., Dibrov P., Kirsch D., Karpel R., Schuldiner S., Padan E., 1994, A single amino acid substitution (Glu134-->Ala) in NhaR1 increases the inducibility by Na+ of the product of nhaA, a Na+/H+ antiporter gene in Escherichia coli., EMBO J 13(8):1981-9

 [2] Henikoff S., Haughn GW., Calvo JM., Wallace JC., 1988, A large family of bacterial activator proteins., Proc Natl Acad Sci U S A 85(18):6602-6

 [3] Mackie GA., 1986, Structure of the DNA distal to the gene for ribosomal protein S20 in Escherichia coli K12: presence of a strong terminator and an IS1 element., Nucleic Acids Res 14(17):6965-81

 [4] Rahav-Manor O., Carmel O., Karpel R., Taglicht D., Glaser G., Schuldiner S., Padan E., 1992, NhaR, a protein homologous to a family of bacterial regulatory proteins (LysR), regulates nhaA, the sodium proton antiporter gene in Escherichia coli., J Biol Chem 267(15):10433-8

 [5] Yura T., Mori H., Nagai H., Nagata T., Ishihama A., Fujita N., Isono K., Mizobuchi K., Nakata A., 1992, Systematic sequencing of the Escherichia coli genome: analysis of the 0-2.4 min region., Nucleic Acids Res 20(13):3305-8

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB