RegulonDB RegulonDB 10.7: Gene Form
   

ribF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ileS ribF yaaY DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp anti-anti-terminator anti-terminator terminator lspAp lspAp TSS_72 TSS_72 TSS_71 TSS_71 TSS_70 TSS_70 TSS_69 TSS_69 TSS_68 TSS_68 TSS_67 (cluster) TSS_67 (cluster) TSS_66 (cluster) TSS_66 (cluster) TSS_65 (cluster) TSS_65 (cluster) TSS_64 TSS_64 TSS_63 TSS_63 TSS_62 TSS_62 ileSp3 ileSp3 TSS_60 TSS_60 TSS_59 TSS_59 ileSp2 ileSp2 TSS_58 (cluster) TSS_58 (cluster) ileSp1 ileSp1 ribFp ribFp rpsTp1 rpsTp1 TSS_56 (cluster) TSS_56 (cluster)

Gene      
Name: ribF    Texpresso search in the literature
Synonym(s): ECK0026, EG11079, b0025, yaaC
Genome position(nucleotides): 21407 --> 22348 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.61
External database links:  
ASAP:
ABE-0000091
CGSC:
35833
ECHOBASE:
EB1071
OU-MICROARRAY:
b0025
PORTECO:
ribF
REGULONDB:
b0025
STRING:
511145.b0025
M3D: ribF
COLOMBOS: ribF
PortEco: b0025


Product      
Name: bifunctional riboflavin kinase / FMN adenylyltransferase
Synonym(s): RibF, YaaC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.734
Isoelectric point: 9.677
Motif(s):
 
Type Positions Sequence
185 -> 307 LGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVKGVYAVEVLGLGEKPLPGVANIGTRPTVAGIRQQLEVHLLDVAMDLYGRHIQVVLRKKIRNEQRFASLDELKAQIARDELTAREFF
13 -> 168 APQEGCVLTIGNFDGVHRGHRALLQGLQEEGRKRNLPVMVMLFEPQPLELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTAQNFISDLLVKHLRVKFLAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVRISSTA
108 -> 108 I
128 -> 169 RFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVRISSTAV
214 -> 214 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.9 - riboflavin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0003919 - FMN adenylyltransferase activity
GO:0005524 - ATP binding
GO:0008531 - riboflavin kinase activity
biological_process GO:0008152 - metabolic process
GO:0006747 - FAD biosynthetic process
GO:0009231 - riboflavin biosynthetic process
GO:0009398 - FMN biosynthetic process
GO:0016310 - phosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35789N
ECOCYC:
RIBF-MONOMER
ECOLIWIKI:
b0025
INTERPRO:
IPR002606
INTERPRO:
IPR023465
INTERPRO:
IPR023468
INTERPRO:
IPR014729
INTERPRO:
IPR015864
INTERPRO:
IPR015865
MINT:
MINT-1256514
MODBASE:
P0AG40
PANTHER:
PTHR22749
PFAM:
PF06574
PFAM:
PF01687
PRIDE:
P0AG40
PRODB:
PRO_000023754
PROTEINMODELPORTAL:
P0AG40
REFSEQ:
NP_414566
SMART:
SM00904
SMR:
P0AG40
UNIPROT:
P0AG40


Operon      
Name: ribF-ileS-lspA-fkpB-ispH         
Operon arrangement:
Transcription unit        Promoter
ribF-ileS-lspA-fkpB-ispH
ileS-lspA-fkpB-ispH
ileS-lspA-fkpB-ispH
ileS-lspA-fkpB-ispH
lsp-fkpB-ispH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_56 (cluster) 21208 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_58 (cluster) 21834 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_59 22220 forward nd [RS-EPT-CBR] [1]
  promoter TSS_60 22222 forward nd [RS-EPT-CBR] [1]
  promoter TSS_62 22244 forward nd [RS-EPT-CBR] [1]
  promoter TSS_63 22262 forward nd [RS-EPT-CBR] [1]
  promoter TSS_64 22279 forward nd [RS-EPT-CBR] [1]
  promoter TSS_65 (cluster) 22306 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_66 (cluster) 22371 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_67 (cluster) 23007 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_68 23888 forward nd [RS-EPT-CBR] [1]
  promoter TSS_69 24198 forward nd [RS-EPT-CBR] [1]
  promoter TSS_70 24243 forward nd [RS-EPT-CBR] [1]
  promoter TSS_71 24709 forward nd [RS-EPT-CBR] [1]
  promoter TSS_72 24918 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB