RegulonDB RegulonDB 10.7: Gene Form
   

fkpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ispH lspA fkpB

Gene      
Name: fkpB    Texpresso search in the literature
Synonym(s): ECK0029, EG11080, b0028, slpA, yaaD
Genome position(nucleotides): 25826 --> 26275 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.44
External database links:  
ASAP:
ABE-0000101
ECHOBASE:
EB1072
OU-MICROARRAY:
b0028
PORTECO:
fkpB
REGULONDB:
b0028
STRING:
511145.b0028
M3D: fkpB
COLOMBOS: fkpB
PortEco: b0028


Product      
Name: peptidyl-prolyl cis-trans isomerase FkpB
Synonym(s): FkpB, SlpA, YaaD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.081
Isoelectric point: 4.062
Motif(s):
 
Type Positions Sequence
5 -> 141 VQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLSEGLEQHLLGLKVGDKTTFSLEPDAAFGVPSPDLIQYFSRREFMDAGEPEIGAIMLFTAMDGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVL
2 -> 72 SESVQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLSEGLEQHLLGLKVGDKTTFSLEPDAAFG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0003755 - peptidyl-prolyl cis-trans isomerase activity
biological_process GO:0061077 - chaperone-mediated protein folding
GO:0000413 - protein peptidyl-prolyl isomerization
Note(s): Note(s): ...[more].
Reference(s): [1] Guo W., et al., 2012
External database links:  
DIP:
DIP-35792N
ECOCYC:
EG11080-MONOMER
ECOLIWIKI:
b0028
INTERPRO:
IPR001179
PANTHER:
PTHR43811
PDB:
4DT4
PDB:
2M2A
PDB:
5I7Q
PFAM:
PF00254
PRIDE:
P0AEM0
PRODB:
PRO_000022634
PROSITE:
PS50059
PROTEINMODELPORTAL:
P0AEM0
REFSEQ:
NP_414569
SMR:
P0AEM0
UNIPROT:
P0AEM0


Operon      
Name: ribF-ileS-lspA-fkpB-ispH         
Operon arrangement:
Transcription unit        Promoter
ribF-ileS-lspA-fkpB-ispH
ileS-lspA-fkpB-ispH
ileS-lspA-fkpB-ispH
ileS-lspA-fkpB-ispH
lsp-fkpB-ispH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Guo W., Hao H., Dai M., Wang Y., Huang L., Peng D., Wang X., Wang H., Yao M., Sun Y., Liu Z., Yuan Z., 2012, Development of quinoxaline 1, 4-dioxides resistance in Escherichia coli and molecular change under resistance selection., PLoS One 7(8):e43322


RegulonDB