RegulonDB RegulonDB 10.8: Gene Form
   

mraZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cra rsmH mraZ ftsL LexA MraZ MraZ MraZ PdhR ftsLp2 ftsLp2 ftsLp1 ftsLp1 TSS_158 TSS_158 TSS_157 (cluster) TSS_157 (cluster) mraWp1 mraWp1 mraZp mraZp TSS_156 (cluster) TSS_156 (cluster) TSS_155 (cluster) TSS_155 (cluster) TSS_154 TSS_154

Gene      
Name: mraZ    Texpresso search in the literature
Synonym(s): ECK0082, EG11084, b0081, yabB
Genome position(nucleotides): 89634 --> 90092 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.07
External database links:  
ASAP:
ABE-0000302
ECHOBASE:
EB1076
OU-MICROARRAY:
b0081
PortEco:
mraZ
STRING:
511145.b0081
COLOMBOS: mraZ


Product      
Name: DNA-binding transcriptional repressor MraZ
Synonym(s): MraZ, YabB
Sequence: Get amino acid sequence Fasta Format
Cellular location: bacterial nucleoid,cytosol
Molecular weight: 17.386
Isoelectric point: 5.258
Motif(s):
 
Type Positions Sequence
15 -> 15 R
77 -> 135 LLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETTWHQQVKEDIDA
81 -> 124 ASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETT
1 -> 75 MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIYHPCLLLYPLPEWEIIEQKLSRLSSMNPVERRVQR
5 -> 52 ATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIYHPCLLLYPLPE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009295 - nucleoid
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:2000143 - negative regulation of DNA-templated transcription, initiation
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
[IPI] Inferred from physical interaction
Reference(s): [1] Eraso JM., et al., 2014
External database links:  
DIP:
DIP-11166N
ECOCYC:
EG11084-MONOMER
ECOLIWIKI:
b0081
INTERPRO:
IPR007159
INTERPRO:
IPR038619
INTERPRO:
IPR037914
INTERPRO:
IPR035644
INTERPRO:
IPR035642
INTERPRO:
IPR020603
INTERPRO:
IPR003444
MODBASE:
P22186
PANTHER:
PTHR34701
PFAM:
PF02381
PRIDE:
P22186
PRODB:
PRO_000023284
PRODOM:
PD006745
PROSITE:
PS51740
REFSEQ:
NP_414623
SMR:
P22186
UNIPROT:
P22186


Operon      
Name: mraZ-rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC         
Operon arrangement:
Transcription unit        Promoter
mraZW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
mraW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsQ
ftsQAZ
ftsAZ
ftsZ
ftsZ
ftsZ
lpxC
lpxC


Transcriptional Regulation      
Display Regulation             
Repressed by: MraZ, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_154 89040 forward nd [RS-EPT-CBR] [2]
  promoter TSS_155 (cluster) 89360 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_156 (cluster) 89589 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_157 (cluster) 90327 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_158 90367 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Eraso JM., Markillie LM., Mitchell HD., Taylor RC., Orr G., Margolin W., 2014, The Highly Conserved MraZ Protein Is a Transcriptional Regulator in Escherichia coli., J Bacteriol 196(11):2053-66

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB