RegulonDB RegulonDB 10.8: Gene Form
   

secM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

secA lpxC secM anti-terminator anti-anti-terminator terminator TSS_221 TSS_221 TSS_220 (cluster) TSS_220 (cluster) TSS_219 TSS_219 TSS_218 TSS_218 TSS_217 TSS_217 TSS_216 (cluster) TSS_216 (cluster) TSS_215 (cluster) TSS_215 (cluster) TSS_214 TSS_214 TSS_213 TSS_213 TSS_212 TSS_212 TSS_211 TSS_211 TSS_210 TSS_210 TSS_209 (cluster) TSS_209 (cluster) TSS_208 TSS_208 TSS_207 TSS_207 TSS_206 TSS_206 TSS_205 TSS_205 TSS_204 TSS_204 TSS_203 TSS_203 TSS_202 TSS_202 TSS_201 TSS_201 TSS_200 TSS_200 TSS_199 TSS_199 TSS_198 TSS_198 TSS_197 TSS_197 TSS_196 TSS_196 TSS_195 TSS_195 TSS_194 TSS_194

Gene      
Name: secM    Texpresso search in the literature
Synonym(s): ECK0098, EG11087, b0097, srrA, yacA
Genome position(nucleotides): 107705 --> 108217 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.0
Reference(s): [1] Sarker S., et al., 2000
External database links:  
ASAP:
ABE-0000340
ECHOBASE:
EB1079
OU-MICROARRAY:
b0097
PortEco:
secM
STRING:
511145.b0097
COLOMBOS: secM


Product      
Name: SecA translation regulator
Synonym(s): SecM, SrrA, YacA, secretion monitor
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol
Molecular weight: 18.88
Isoelectric point: 10.438
Motif(s):
 
Type Positions Sequence
1 -> 37 MSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALSNA
166 -> 170 PQRLT
29 -> 33 LGLPA
163 -> 163 R
31 -> 34 LPAL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.5 - export, signal peptide cleavage
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.1 - translation attenuation and efficiency
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0045182 - translation regulator activity
biological_process GO:0006417 - regulation of translation
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [2] Fikes JD., et al., 1989
[3] Fortin Y., et al., 1990
[4] Schmidt MG., et al., 1991
[5] Schmidt MO., et al., 2001
[6] Serres MH., et al., 2001
[7] Vazquez-Laslop N., et al., 2011
External database links:  
ECOCYC:
EG11087-MONOMER
ECOLIWIKI:
b0097
INTERPRO:
IPR009502
PDB:
3JBV
PDB:
2N62
PFAM:
PF06558
PRIDE:
P62395
PRODB:
PRO_000023929
PRODOM:
PD089227
REFSEQ:
NP_414639
SMR:
P62395
UNIPROT:
P62395


Operon      
Name: secMA-mutT         
Operon arrangement:
Transcription unit        Promoter
secMA-mutT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_194 106940 forward nd [RS-EPT-CBR] [8]
  promoter TSS_195 107603 forward nd [RS-EPT-CBR] [8]
  promoter TSS_196 107668 forward nd [RS-EPT-CBR] [8]
  promoter TSS_197 108025 forward nd [RS-EPT-CBR] [8]
  promoter TSS_198 108134 forward nd [RS-EPT-CBR] [8]
  promoter TSS_199 108703 forward nd [RS-EPT-CBR] [8]
  promoter TSS_200 108722 forward nd [RS-EPT-CBR] [8]
  promoter TSS_201 108821 forward nd [RS-EPT-CBR] [8]
  promoter TSS_202 109037 forward nd [RS-EPT-CBR] [8]
  promoter TSS_203 109101 forward nd [RS-EPT-CBR] [8]
  promoter TSS_204 109106 forward nd [RS-EPT-CBR] [8]
  promoter TSS_205 109414 forward nd [RS-EPT-CBR] [8]
  promoter TSS_206 109478 forward nd [RS-EPT-CBR] [8]
  promoter TSS_207 110273 forward nd [RS-EPT-CBR] [8]
  promoter TSS_208 110296 forward nd [RS-EPT-CBR] [8]
  promoter TSS_209 (cluster) 110304 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_210 110313 forward nd [RS-EPT-CBR] [8]
  promoter TSS_211 110324 forward nd [RS-EPT-CBR] [8]
  promoter TSS_212 110327 forward nd [RS-EPT-CBR] [8]
  promoter TSS_213 110338 forward nd [RS-EPT-CBR] [8]
  promoter TSS_214 110340 forward nd [RS-EPT-CBR] [8]
  promoter TSS_215 (cluster) 110667 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_216 (cluster) 110671 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_217 110684 forward nd [RS-EPT-CBR] [8]
  promoter TSS_218 110686 forward nd [RS-EPT-CBR] [8]
  promoter TSS_219 110690 forward nd [RS-EPT-CBR] [8]
  promoter TSS_220 (cluster) 110694 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_221 110709 forward nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sarker S., Rudd KE., Oliver D., 2000, Revised translation start site for secM defines an atypical signal peptide that regulates Escherichia coli secA expression., J Bacteriol 182(19):5592-5

 [2] Fikes JD., Bassford PJ., 1989, Novel secA alleles improve export of maltose-binding protein synthesized with a defective signal peptide., J Bacteriol 171(1):402-9

 [3] Fortin Y., Phoenix P., Drapeau GR., 1990, Mutations conferring resistance to azide in Escherichia coli occur primarily in the secA gene., J Bacteriol 172(11):6607-10

 [4] Schmidt MG., Dolan KM., Oliver DB., 1991, Regulation of Escherichia coli secA mRNA translation by a secretion-responsive element., J Bacteriol 173(20):6605-11

 [5] Schmidt MO., Brosh RM., Oliver DB., 2001, Escherichia coli SecA helicase activity is not required in vivo for efficient protein translocation or autogenous regulation., J Biol Chem 276(40):37076-85

 [6] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035

 [7] Vazquez-Laslop N., Mankin AS., 2011, Picky nascent peptides do not talk to foreign ribosomes., Proc Natl Acad Sci U S A 108(15):5931-2

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB