RegulonDB RegulonDB 10.7: Gene Form
   

yacC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cueO speE yacC CueR TSS_265 TSS_265 TSS_264 TSS_264 TSS_263 (cluster) TSS_263 (cluster) cueOp cueOp yacCp yacCp speEp speEp speDp speDp

Gene      
Name: yacC    Texpresso search in the literature
Synonym(s): ECK0121, EG11089, b0122
Genome position(nucleotides): 136570 <-- 136917 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0000423
ECHOBASE:
EB1081
OU-MICROARRAY:
b0122
PORTECO:
yacC
REGULONDB:
b0122
STRING:
511145.b0122
M3D: yacC
COLOMBOS: yacC
PortEco: b0122


Product      
Name: putative lipoprotein YacC
Synonym(s): YacC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 12.854
Isoelectric point: 5.067
Motif(s):
 
Type Positions Sequence
21 -> 115 YALSESEAEDMADLTAVFVFLKNDCGYQNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALARDSLSLLAYVK
1 -> 20 MKTFFRTVLFGSLMAVCANS
24 -> 105 SESEAEDMADLTAVFVFLKNDCGYQNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALAR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11089-MONOMER
ECOLIWIKI:
b0122
INTERPRO:
IPR019114
INTERPRO:
IPR038432
PFAM:
PF09691
PRIDE:
P0AA95
PROTEINMODELPORTAL:
P0AA95
REFSEQ:
NP_414664
SMR:
P0AA95
UNIPROT:
P0AA95


Operon      
Name: yacC-speED         
Operon arrangement:
Transcription unit        Promoter
speD
speE
yacC-speED


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_263 (cluster) 137048 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_264 137069 forward nd [RS-EPT-CBR] [1]
  promoter TSS_265 137630 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB