RegulonDB RegulonDB 10.10: Gene Form
   

frsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

frsA insB9 gpt insA9 terminator anti-terminator anti-anti-terminator crlp2 crlp2 crlp1 crlp1 TSS_455 TSS_455 frsAp frsAp

Gene      
Name: frsA    Texpresso search in the literature
Synonym(s): ECK0240, EG11091, b0239, yafA
Genome position(nucleotides): 256527 --> 257771 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.65
External database links:  
ASAP:
ABE-0000817
ECHOBASE:
EB1083
ECOLIHUB:
frsA
OU-MICROARRAY:
b0239
STRING:
511145.b0239
COLOMBOS: frsA


Product      
Name: fermentation-respiration switch protein
Synonym(s): FrsA, YafA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 47.009
Isoelectric point: 6.956
Motif(s):
 
Type Positions Sequence
397 -> 414 NFDKGLQEITDWIEKRLC
1 -> 414 MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIPHWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQAMVWQQKACAEDDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQRLPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRGIAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVRLAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELNRYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFDKGLQEITDWIEKRLC
277 -> 278 NV
242 -> 242 T

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0080030 - methyl indole-3-acetate esterase activity
GO:0016788 - hydrolase activity, acting on ester bonds
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0052689 - carboxylic ester hydrolase activity
biological_process GO:0043470 - regulation of carbohydrate catabolic process
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
Reference(s): [1] Koo BM., et al., 2004
[2] Kuznetsova E., et al., 2005
External database links:  
DIP:
DIP-11208N
ECOCYC:
EG11091-MONOMER
ECOLIWIKI:
b0239
INTERPRO:
IPR043423
INTERPRO:
IPR029058
INTERPRO:
IPR010520
MODBASE:
P04335
PFAM:
PF06500
PRIDE:
P04335
PRODB:
PRO_000022698
REFSEQ:
NP_414774
SMR:
P04335
UNIPROT:
P04335


Operon      
Name: frsA         
Operon arrangement:
Transcription unit        Promoter
frsA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_455 256509 forward nd [RS-EPT-CBR] [3]
  promoter crlp1 257810 forward Zaslaver et al. demonstrated
Read more >
[HTTIM], [IEP], [IHBCE], [IPI], [RS-EPT-CBR], [TIM] [3], [4], [5], [6], [7], [8]
  promoter crlp1 257810 forward This promoter initiates
Read more >
[HTTIM], [IEP], [IPI], [RS-EPT-CBR], [TIM] [3], [4], [5], [6], [8]
  promoter crlp2 257824 forward The crlp2 promoter appears
Read more >
[HIPP], [ICWHO], [IEP], [IHBCE], [IMP] [9], [10], [11]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [HTTIM] High-throughput transcription initiation mapping

 [IEP] Inferred from expression pattern

 [IHBCE] Inferred by a human based on computational evidence

 [IPI] Inferred from physical interaction

 [TIM] Transcription initiation mapping

 [HIPP] Human inference of promoter position

 [ICWHO] Inferred computationally without human oversight

 [IMP] Inferred from mutant phenotype



Reference(s)    

 [1] Koo BM., Yoon MJ., Lee CR., Nam TW., Choe YJ., Jaffe H., Peterkofsky A., Seok YJ., 2004, A novel fermentation/respiration switch protein regulated by enzyme IIAGlc in Escherichia coli., J Biol Chem 279(30):31613-21

 [2] Kuznetsova E., Proudfoot M., Sanders SA., Reinking J., Savchenko A., Arrowsmith CH., Edwards AM., Yakunin AF., 2005, Enzyme genomics: Application of general enzymatic screens to discover new enzymes., FEMS Microbiol Rev 29(2):263-79

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Arnqvist A., Olsen A., Pfeifer J., Russell DG., Normark S., 1992, The Crl protein activates cryptic genes for curli formation and fibronectin binding in Escherichia coli HB101., Mol Microbiol 6(17):2443-52

 [5] Mendoza-Vargas A., Olvera L., Olvera M., Grande R., Vega-Alvarado L., Taboada B., Jimenez-Jacinto V., Salgado H., Juarez K., Contreras-Moreira B., Huerta AM., Collado-Vides J., Morett E., 2009, Genome-wide identification of transcription start sites, promoters and transcription factor binding sites in E. coli., PLoS One 4(10):e7526

 [6] Peano C., Wolf J., Demol J., Rossi E., Petiti L., De Bellis G., Geiselmann J., Egli T., Lacour S., Landini P., 2015, Characterization of the Escherichia coli σ(S) core regulon by Chromatin Immunoprecipitation-sequencing (ChIP-seq) analysis., Sci Rep 5:10469

 [7] Sabina RL., Magill JM., Magill CW., 1976, Regulation of hypoxanthine transport in Neurospora crassa., J Bacteriol 128(2):598-603

 [8] Zaslaver A., Bren A., Ronen M., Itzkovitz S., Kikoin I., Shavit S., Liebermeister W., Surette MG., Alon U., 2006, A comprehensive library of fluorescent transcriptional reporters for Escherichia coli., Nat Methods 3(8):623-8

 [9] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [10] Zafar MA., Carabetta VJ., Mandel MJ., Silhavy TJ., 2014, Transcriptional occlusion caused by overlapping promoters., Proc Natl Acad Sci U S A 111(4):1557-61

 [11] Zhao K., Liu M., Burgess RR., 2010, Promoter and regulon analysis of nitrogen assimilation factor, sigma54, reveal alternative strategy for E. coli MG1655 flagellar biosynthesis., Nucleic Acids Res 38(4):1273-83


RegulonDB