RegulonDB RegulonDB 10.8: Gene Form
   

yaiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aroM aroL yaiA aroMp aroMp TSS_500 TSS_500 TSS_499 TSS_499

Gene      
Name: yaiA    Texpresso search in the literature
Synonym(s): ECK0384, EG11093, b0389
Genome position(nucleotides): 406979 --> 407170 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.44
External database links:  
ASAP:
ABE-0001355
ECHOBASE:
EB1085
OU-MICROARRAY:
b0389
PortEco:
yaiA
STRING:
511145.b0389
COLOMBOS: yaiA


Product      
Name: protein YaiA
Synonym(s): YaiA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.281
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
1 -> 63 MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDPDKE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48130N
ECOCYC:
EG11093-MONOMER
ECOLIWIKI:
b0389
INTERPRO:
IPR038462
INTERPRO:
IPR032303
PDB:
2KVT
PFAM:
PF16362
PRIDE:
P0AAN5
REFSEQ:
NP_414923
SMR:
P0AAN5
UNIPROT:
P0AAN5


Operon      
Name: aroL-yaiA-aroM         
Operon arrangement:
Transcription unit        Promoter
aroL-yaiA-aroM
aroL-yaiA-aroM
aroM
yaiA-aroM


Transcriptional Regulation      
Display Regulation             
Repressed by: TyrR, TrpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_499 406954 forward nd [RS-EPT-CBR] [1]
  promoter TSS_500 407091 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB