RegulonDB RegulonDB 10.8: Gene Form
   

ybaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeB ybaA ffs terminator TSS_611 TSS_611 TSS_610 TSS_610

Gene      
Name: ybaA    Texpresso search in the literature
Synonym(s): ECK0450, EG11099, b0456
Genome position(nucleotides): 476672 --> 477025 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.44
External database links:  
ASAP:
ABE-0001582
ECHOBASE:
EB1091
OU-MICROARRAY:
b0456
PortEco:
ybaA
STRING:
511145.b0456
COLOMBOS: ybaA


Product      
Name: DUF1428 domain-containing protein YbaA
Synonym(s): YbaA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.318
Isoelectric point: 4.482
Motif(s):
 
Type Positions Sequence
2 -> 103 KYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASDVPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11099-MONOMER
ECOLIWIKI:
b0456
INTERPRO:
IPR011008
INTERPRO:
IPR009874
PFAM:
PF07237
PRIDE:
P0AAQ6
REFSEQ:
NP_414989
SMR:
P0AAQ6
UNIPROT:
P0AAQ6


Operon      
Name: ybaA         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_610 476448 forward nd [RS-EPT-CBR] [1]
  promoter TSS_611 478612 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB